Clone BS21611 Report

Search the DGRC for BS21611

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:216
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptCG33704-RA
Protein status:BS21611.pep: full length peptide match
Sequenced Size:224

Clone Sequence Records

BS21611.complete Sequence

224 bp assembled on 2011-01-18

GenBank Submission: KX802552

> BS21611.complete
GAAGTTATCAGTCGACATGGCGGACATGGAGGAATATAACCATCCATTGG
CGAAAATAACATCTATATCCGAGGAACTGGAACGAACTCATCTGGCCCGC
GTGCCGCAGGTCCTGCAGCGATTGGAGGACATCCGGGAGCCGGAGGATGA
AATGCTGCTGGCTGAAGGTAGTCGACTGAGCAAGAAACTCACTTGGGAGG
ACTACTAGAAGCTTTCTAGACCAT

BS21611.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG33704-RA 192 CG33704-PA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG33704-RA 723 CG33704-RA 117..309 16..208 965 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20950552..20950680 80..208 645 100 Plus
2R 25286936 2R 20950218..20950282 16..80 325 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:21:31 has no hits.

BS21611.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:20 Download gff for BS21611.complete
Subject Subject Range Query Range Percent Splice Strand
CG33704-RA 118..309 17..208 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:54:31 Download gff for BS21611.complete
Subject Subject Range Query Range Percent Splice Strand
CG33704-RA 118..309 17..208 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:02:16 Download gff for BS21611.complete
Subject Subject Range Query Range Percent Splice Strand
CG33704-RA 118..309 17..208 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:02:16 Download gff for BS21611.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20950219..20950282 17..80 100 -> Plus
2R 20950553..20950680 81..208 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:54:31 Download gff for BS21611.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16838058..16838185 81..208 100   Plus
arm_2R 16837724..16837787 17..80 100 -> Plus

BS21611.pep Sequence

Translation from 16 to 207

> BS21611.pep
MADMEEYNHPLAKITSISEELERTHLARVPQVLQRLEDIREPEDEMLLAE
GSRLSKKLTWEDY*

BS21611.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG33704-PA 63 CG33704-PA 1..63 1..63 321 100 Plus