BS21611.complete Sequence
224 bp assembled on 2011-01-18
GenBank Submission: KX802552
> BS21611.complete
GAAGTTATCAGTCGACATGGCGGACATGGAGGAATATAACCATCCATTGG
CGAAAATAACATCTATATCCGAGGAACTGGAACGAACTCATCTGGCCCGC
GTGCCGCAGGTCCTGCAGCGATTGGAGGACATCCGGGAGCCGGAGGATGA
AATGCTGCTGGCTGAAGGTAGTCGACTGAGCAAGAAACTCACTTGGGAGG
ACTACTAGAAGCTTTCTAGACCAT
BS21611.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:21:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33704-RA | 192 | CG33704-PA | 1..192 | 17..208 | 960 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33704-RA | 723 | CG33704-RA | 117..309 | 16..208 | 965 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 20950552..20950680 | 80..208 | 645 | 100 | Plus |
2R | 25286936 | 2R | 20950218..20950282 | 16..80 | 325 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:21:31 has no hits.
BS21611.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-20 15:40:20 Download gff for
BS21611.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33704-RA | 118..309 | 17..208 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:54:31 Download gff for
BS21611.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33704-RA | 118..309 | 17..208 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:02:16 Download gff for
BS21611.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33704-RA | 118..309 | 17..208 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:02:16 Download gff for
BS21611.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20950219..20950282 | 17..80 | 100 | -> | Plus |
2R | 20950553..20950680 | 81..208 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:54:31 Download gff for
BS21611.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 16838058..16838185 | 81..208 | 100 | | Plus |
arm_2R | 16837724..16837787 | 17..80 | 100 | -> | Plus |
BS21611.pep Sequence
Translation from 16 to 207
> BS21611.pep
MADMEEYNHPLAKITSISEELERTHLARVPQVLQRLEDIREPEDEMLLAE
GSRLSKKLTWEDY*
BS21611.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:06:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33704-PA | 63 | CG33704-PA | 1..63 | 1..63 | 321 | 100 | Plus |