BS21652.complete Sequence
224 bp assembled on 2011-01-18
GenBank Submission: KX806180
> BS21652.complete
GAAGTTATCAGTCGACATGAACTTCTACAACATCTTCGTTTTCGTCGCTC
TCATTCTGGCCATCACCATTGGACAATCGGAAGCTGGTTGGCTAAAGAAA
ATTGGCAAGAAAATCGAACGTGTTGGTCAGCACACTCGCGACGCCACAAT
CCAGGGACTGGGAATCGCTCAACAGGCCGCCAATGTTGCAGCCACTGCTC
GAGGTTAAAAGCTTTCTAGACCAT
BS21652.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:43:44
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CecA2-RA | 192 | CG1367-PA | 1..192 | 17..208 | 960 | 100 | Plus |
| CecA1-RA | 192 | CG1365-PA | 1..190 | 17..206 | 800 | 94.7 | Plus |
| CecC-RA | 192 | CG1373-PA | 1..179 | 17..195 | 565 | 87.7 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:43:45
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CecA2-RA | 355 | CG1367-RA | 82..274 | 16..208 | 965 | 100 | Plus |
| CecA1-RA | 339 | CG1365-RA | 74..264 | 16..206 | 805 | 94.8 | Plus |
| CecC-RA | 386 | CG1373-RA | 93..272 | 16..195 | 570 | 87.8 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:43:41
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 30212237..30212337 | 16..116 | 505 | 100 | Plus |
| 3R | 32079331 | 3R | 30210947..30211047 | 16..116 | 475 | 98 | Plus |
| 3R | 32079331 | 3R | 30212395..30212487 | 116..208 | 465 | 100 | Plus |
| 3R | 32079331 | 3R | 30216576..30216676 | 16..116 | 385 | 92.1 | Plus |
| 3R | 32079331 | 3R | 30211108..30211198 | 116..206 | 335 | 91.2 | Plus |
| 3R | 32079331 | 3R | 30213474..30213568 | 210..116 | 265 | 85.3 | Minus |
| 3R | 32079331 | 3R | 30216752..30216824 | 123..195 | 200 | 84.9 | Plus |
| 3R | 32079331 | 3R | 30213626..30213730 | 116..12 | 195 | 79 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:43:43 has no hits.
BS21652.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:35 Download gff for
BS21652.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CecA2-RA | 83..272 | 17..206 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:03 Download gff for
BS21652.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CecA2-RA | 83..272 | 17..206 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:19:00 Download gff for
BS21652.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CecA2-RA | 83..272 | 17..206 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:19:00 Download gff for
BS21652.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 30212238..30212336 | 17..115 | 100 | -> | Plus |
| 3R | 30212395..30212485 | 116..206 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:03 Download gff for
BS21652.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 26037960..26038058 | 17..115 | 100 | -> | Plus |
| arm_3R | 26038117..26038207 | 116..206 | 100 | | Plus |
BS21652.pep Sequence
Translation from 16 to 207
> BS21652.pep
MNFYNIFVFVALILAITIGQSEAGWLKKIGKKIERVGQHTRDATIQGLGI
AQQAANVAATARG*
BS21652.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:30
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CecA2-PA | 63 | CG1367-PA | 1..63 | 1..63 | 313 | 100 | Plus |
| CecA1-PA | 63 | CG1365-PA | 1..63 | 1..63 | 313 | 100 | Plus |
| CecC-PA | 63 | CG1373-PA | 1..63 | 1..63 | 297 | 92.1 | Plus |
| CecB-PA | 63 | CG1878-PA | 1..63 | 1..63 | 268 | 84.1 | Plus |
