BS21750.complete Sequence
425 bp assembled on 2011-02-01
GenBank Submission: KX804247
> BS21750.complete
GAAGTTATCAGTCGACATGTCTCTGAATCTGCAGTACGAGGACATTGGCA
AGGAATTTGTCCAGCAGTACTACGCCATATTCGATGACCCGGCGAATCGG
GAGAACGTGATTAATTTCTATAACGCTACCGACTCTTTCATGACCTTTGA
AGGCAACCAAATACAGGGAGCACCCAAGATTCTGGAAAAAGTTCAGAGTC
TGAGCTTTCAGAAGATTGCCAGAGTGATAACCACAGTGGATTCGCAGCCA
ACTTCCGATGGCGGAGTTCTGATCATCGTCCTTGGAAGACTAAAATGCGA
TGACGATCCCCCACATGCATTCTCGCAGATCTTTTTGCTGAAGCCCAACG
GAGGATCCCTCTTCGTGGCTCACGACATCTTCCGTCTGAACATCCACAAC
TCTGCCTAGAAGCTTTCTAGACCAT
BS21750.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Ntf-2r-RA | 393 | CG10174-PA | 1..393 | 17..409 | 1965 | 100 | Plus |
| Ntf-2-RE | 393 | CG1740-PE | 1..393 | 17..409 | 1530 | 92.6 | Plus |
| Ntf-2-RA | 393 | CG1740-PA | 1..393 | 17..409 | 1530 | 92.6 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:28
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Ntf-2r-RA | 771 | CG10174-RA | 119..525 | 17..423 | 1975 | 99 | Plus |
| Ntf-2-RE | 3078 | CG1740-RE | 146..542 | 17..413 | 1535 | 92.4 | Plus |
| Ntf-2-RA | 755 | CG1740-RA | 146..542 | 17..413 | 1535 | 92.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:49:25
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 18454767..18455173 | 17..423 | 1975 | 99 | Plus |
| X | 23542271 | X | 21036536..21036634 | 194..292 | 435 | 96 | Plus |
| X | 23542271 | X | 21035614..21035719 | 17..122 | 410 | 92.5 | Plus |
| X | 23542271 | X | 21038746..21038863 | 296..413 | 410 | 89.8 | Plus |
| X | 23542271 | X | 21036399..21036470 | 125..196 | 315 | 95.8 | Plus |
Blast to na_te.dros performed on 2014-11-26 21:49:26 has no hits.
BS21750.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-02-01 15:39:35 Download gff for
BS21750.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Ntf-2r-RA | 46..438 | 17..409 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:37:50 Download gff for
BS21750.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Ntf-2r-RA | 119..511 | 17..409 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:13 Download gff for
BS21750.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Ntf-2r-RA | 119..511 | 17..409 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:43:13 Download gff for
BS21750.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 18454767..18455159 | 17..409 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:37:50 Download gff for
BS21750.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 18454767..18455159 | 17..409 | 100 | | Plus |
BS21750.pep Sequence
Translation from 16 to 408
> BS21750.pep
MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQ
GAPKILEKVQSLSFQKIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPH
AFSQIFLLKPNGGSLFVAHDIFRLNIHNSA*
BS21750.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:59:09
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Ntf-2r-PA | 130 | CG10174-PA | 1..130 | 1..130 | 672 | 100 | Plus |
| Ntf-2-PE | 130 | CG1740-PE | 1..130 | 1..130 | 594 | 87.7 | Plus |
| Ntf-2-PA | 130 | CG1740-PA | 1..130 | 1..130 | 594 | 87.7 | Plus |
| Ntf-2-PB | 129 | CG1740-PB | 1..128 | 1..128 | 543 | 82 | Plus |
| Ntf-2-PC | 89 | CG1740-PC | 1..89 | 42..130 | 403 | 87.6 | Plus |
