Clone BS21761 Report

Search the DGRC for BS21761

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:217
Well:61
Vector:pDNR-Dual
Associated Gene/Transcriptcer-RA
Protein status:BS21761.pep: full length peptide match
Sequenced Size:272

Clone Sequence Records

BS21761.complete Sequence

272 bp assembled on 2011-02-01

GenBank Submission: KX803524

> BS21761.complete
GAAGTTATCAGTCGACATGTCCCTGGTTTCAGATGAGGAGTGGGTGGAGT
ACAAGTCCAAGTTCGACAAGAACTACGAGGCAGAGGAGGATCTGATGCGT
CGTAGAATCTACGCCGAGTCCAAAGCCCGGATTGAGGAACACAATCGGAA
GTTCGAGAAGGGCGAAGTGACTTGGAAAATGGGAATTAATCATTTGGCTG
ATCTCACGCCTGAGGAATTTGCCCAGCGTTGTGGCAAAAAGGTGCCGCCA
AATTAAAAGCTTTCTAGACCAT

BS21761.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
cer-RA 240 CG10460-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
cer-RA 497 CG10460-RA 111..350 17..256 1200 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19396362..19396564 256..54 1015 100 Minus
2R 25286936 2R 19396624..19396662 55..17 195 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:49:39 has no hits.

BS21761.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-02-01 15:39:36 Download gff for BS21761.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 113..350 17..254 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:37:58 Download gff for BS21761.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 111..348 17..254 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:21 Download gff for BS21761.complete
Subject Subject Range Query Range Percent Splice Strand
cer-RA 111..348 17..254 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:43:21 Download gff for BS21761.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19396364..19396562 56..254 100 <- Minus
2R 19396624..19396662 17..55 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:37:58 Download gff for BS21761.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15283869..15284067 56..254 100 <- Minus
arm_2R 15284129..15284167 17..55 100   Minus

BS21761.pep Sequence

Translation from 16 to 255

> BS21761.pep
MSLVSDEEWVEYKSKFDKNYEAEEDLMRRRIYAESKARIEEHNRKFEKGE
VTWKMGINHLADLTPEEFAQRCGKKVPPN*

BS21761.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
cer-PA 79 CG10460-PA 1..79 1..79 423 100 Plus
Cp1-PA 341 CG6692-PA 27..91 7..70 138 41.5 Plus
Cp1-PC 371 CG6692-PC 57..121 7..70 138 41.5 Plus