BS21930.complete Sequence
416 bp assembled on 2011-01-25
GenBank Submission: KX803063
> BS21930.complete
GAAGTTATCAGTCGACATGCCGTACATAATCATACGGGGGAATCTAGCCT
CCTACAGCCACAAATATCCATGGAGGGTGCTCGTCTCCGGGTTGAAAGCT
GACGACATCGAGCAGTTGAACAAGTTCTCCTGCGGCGGCTACAGCGACGA
GTCCACCATCGTCTACTTAGTGCATCCTTGTCGGATTTTATCGGCGCTAG
AAATCCTGGGATTTCGCGTAGTGGCCAGCTCATCGACTGCCGTGAAGCAG
GACTACAACGAGTACATGTGGACGATGCGCAAGGAGTTCGACGAACCAGA
ACCCTTGGAAGCCGAGTCCGTGGTGCGAGAAAATCTATCGAATATTGGCC
GCGAGGCAGCCAGTTTAGGCAACTATCACAAGGTGGATTCGCCTGAATAG
AAGCTTTCTAGACCAT
BS21930.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:36:13
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG33995-RC | 384 | CG33995-PC | 1..384 | 17..400 | 1920 | 100 | Plus |
| CG33995-RB | 384 | CG33995-PB | 1..384 | 17..400 | 1920 | 100 | Plus |
| CG33995-RA | 384 | CG33995-PA | 1..384 | 17..400 | 1920 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:36:14
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG44001-RE | 2431 | CG44001-RE | 156..540 | 17..401 | 1925 | 100 | Plus |
| CG44001-RD | 2415 | CG44001-RD | 140..524 | 17..401 | 1925 | 100 | Plus |
| CG44001-RA | 2691 | CG44001-RA | 416..800 | 17..401 | 1925 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:36:11
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 5046147..5046345 | 203..401 | 995 | 100 | Plus |
| 2L | 23513712 | 2L | 5045820..5045925 | 97..202 | 530 | 100 | Plus |
| 2L | 23513712 | 2L | 5044608..5044689 | 17..98 | 410 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:36:12 has no hits.
BS21930.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:24 Download gff for
BS21930.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG31919-RE | 152..535 | 17..400 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:00:56 Download gff for
BS21930.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG44001-RA | 416..799 | 17..400 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:16 Download gff for
BS21930.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG44001-RA | 416..799 | 17..400 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:16 Download gff for
BS21930.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 5044608..5044689 | 17..98 | 100 | -> | Plus |
| 2L | 5045822..5045925 | 99..202 | 100 | -> | Plus |
| 2L | 5046147..5046344 | 203..400 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:00:56 Download gff for
BS21930.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 5044608..5044689 | 17..98 | 100 | -> | Plus |
| arm_2L | 5045822..5045925 | 99..202 | 100 | -> | Plus |
| arm_2L | 5046147..5046344 | 203..400 | 100 | | Plus |
BS21930.pep Sequence
Translation from 16 to 399
> BS21930.pep
MPYIIIRGNLASYSHKYPWRVLVSGLKADDIEQLNKFSCGGYSDESTIVY
LVHPCRILSALEILGFRVVASSSTAVKQDYNEYMWTMRKEFDEPEPLEAE
SVVRENLSNIGREAASLGNYHKVDSPE*
BS21930.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:08:10
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG33995-PC | 127 | CG33995-PC | 1..127 | 1..127 | 663 | 100 | Plus |
| CG33995-PB | 127 | CG33995-PB | 1..127 | 1..127 | 663 | 100 | Plus |
| CG33995-PA | 127 | CG33995-PA | 1..127 | 1..127 | 663 | 100 | Plus |
