Clone BS21932 Report

Search the DGRC for BS21932

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptMet75Ca-RA
Protein status:BS21932.pep: gold
Sequenced Size:188

Clone Sequence Records

BS21932.complete Sequence

188 bp assembled on 2011-01-25

GenBank Submission: KX806481

> BS21932.complete
GAAGTTATCAGTCGACATGAACGTATTCAATGGTTTCTTGCTAGTCTTCC
TGGGCCTGGCCCTCAGCTCTGTGGATGCACAGATAGCAACACGCCAGGAA
ACCTCGGAGGACAAGGCTTGTGGTCCCCACGCCTACTACAATTACGCCCG
GCACACTTGCCTGCCATTCTAGAAGCTTTCTAGACCAT

BS21932.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:44:19
Subject Length Description Subject Range Query Range Score Percent Strand
Met75Ca-RA 156 CG32197-PA 1..156 17..172 780 100 Plus
Met75Cb-RA 156 CG18064-PA 1..156 17..172 780 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
Met75Ca-RA 242 CG32197-RA 21..176 17..172 780 100 Plus
Met75Cb-RA 241 CG18064-RA 21..176 17..172 780 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18469443..18469598 172..17 780 100 Minus
3L 28110227 3L 18472209..18472364 172..17 780 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:44:17 has no hits.

BS21932.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:36 Download gff for BS21932.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Ca-RA 21..176 17..172 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:10 Download gff for BS21932.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Ca-RA 21..176 17..172 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:19:11 Download gff for BS21932.complete
Subject Subject Range Query Range Percent Splice Strand
Met75Cb-RA 21..176 17..172 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:19:11 Download gff for BS21932.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18469443..18469598 17..172 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:10 Download gff for BS21932.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18462543..18462698 17..172 100   Minus

BS21932.pep Sequence

Translation from 16 to 171

> BS21932.pep
MNVFNGFLLVFLGLALSSVDAQIATRQETSEDKACGPHAYYNYARHTCLP
F*

BS21932.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
Met75Ca-PA 51 CG32197-PA 1..51 1..51 272 100 Plus
Met75Cb-PA 51 CG18064-PA 1..51 1..51 272 100 Plus