BS21932.complete Sequence
188 bp assembled on 2011-01-25
GenBank Submission: KX806481
> BS21932.complete
GAAGTTATCAGTCGACATGAACGTATTCAATGGTTTCTTGCTAGTCTTCC
TGGGCCTGGCCCTCAGCTCTGTGGATGCACAGATAGCAACACGCCAGGAA
ACCTCGGAGGACAAGGCTTGTGGTCCCCACGCCTACTACAATTACGCCCG
GCACACTTGCCTGCCATTCTAGAAGCTTTCTAGACCAT
BS21932.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:44:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Met75Ca-RA | 156 | CG32197-PA | 1..156 | 17..172 | 780 | 100 | Plus |
Met75Cb-RA | 156 | CG18064-PA | 1..156 | 17..172 | 780 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:44:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Met75Ca-RA | 242 | CG32197-RA | 21..176 | 17..172 | 780 | 100 | Plus |
Met75Cb-RA | 241 | CG18064-RA | 21..176 | 17..172 | 780 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:44:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 18469443..18469598 | 172..17 | 780 | 100 | Minus |
3L | 28110227 | 3L | 18472209..18472364 | 172..17 | 780 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:44:17 has no hits.
BS21932.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:36 Download gff for
BS21932.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Ca-RA | 21..176 | 17..172 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:10 Download gff for
BS21932.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Ca-RA | 21..176 | 17..172 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:19:11 Download gff for
BS21932.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Met75Cb-RA | 21..176 | 17..172 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:19:11 Download gff for
BS21932.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 18469443..18469598 | 17..172 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:10 Download gff for
BS21932.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 18462543..18462698 | 17..172 | 100 | | Minus |
BS21932.pep Sequence
Translation from 16 to 171
> BS21932.pep
MNVFNGFLLVFLGLALSSVDAQIATRQETSEDKACGPHAYYNYARHTCLP
F*
BS21932.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Met75Ca-PA | 51 | CG32197-PA | 1..51 | 1..51 | 272 | 100 | Plus |
Met75Cb-PA | 51 | CG18064-PA | 1..51 | 1..51 | 272 | 100 | Plus |