BS21938.complete Sequence
320 bp assembled on 2011-01-25
GenBank Submission: KX801558
> BS21938.complete
GAAGTTATCAGTCGACATGCACAAAATAGCAGCAGCGCCGCCTCCATCGG
CAACGCCCGGCGGAGGACTGGAGACGCCCCTGGCGGCGCCAAAATACGGC
ACACTAATACCCAATCGCATCTTTGTGGGTGGCATCAGCGGCGATACCAC
CGAGGCTGATCTAACCCGCGTCTTCAGCGCCTATGGCACGGTAAAGAGCA
CCAAAATCATCGTGGATCGAGCAGGTGTGAGCAAGGGCTACGGATTCGTC
ACCTTCGAGACGGAGCAGGAGGCGCAAAGACTGCAAGCGGATGGCATTAC
CTGAAAGCTTTCTAGACCAT
BS21938.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:36:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| bol-RE | 288 | CG4760-PE | 1..288 | 17..304 | 1440 | 100 | Plus |
| bol-RF | 702 | CG4760-PF | 1..278 | 17..294 | 1390 | 100 | Plus |
| bol-RG | 687 | CG4760-PG | 1..278 | 17..294 | 1390 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:36:09
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| bol-RE | 2023 | CG4760-RE | 629..916 | 17..304 | 1440 | 100 | Plus |
| bol-RF | 6538 | CG4760-RF | 780..1057 | 17..294 | 1390 | 100 | Plus |
| bol-RG | 2930 | CG4760-RG | 1199..1476 | 17..294 | 1390 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:36:06
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 9112633..9112789 | 293..137 | 785 | 100 | Minus |
| 3L | 28110227 | 3L | 9113046..9113167 | 138..17 | 610 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:36:07 has no hits.
BS21938.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:24 Download gff for
BS21938.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| bol-RE | 595..881 | 17..303 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:00:54 Download gff for
BS21938.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| bol-RE | 629..915 | 17..303 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:14 Download gff for
BS21938.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| bol-RE | 629..915 | 17..303 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:14 Download gff for
BS21938.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 9112627..9112787 | 139..299 | 98 | <- | Minus |
| 3L | 9113046..9113167 | 17..138 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:00:54 Download gff for
BS21938.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 9105727..9105887 | 139..299 | 98 | <- | Minus |
| arm_3L | 9106146..9106267 | 17..138 | 100 | | Minus |
BS21938.pep Sequence
Translation from 16 to 303
> BS21938.pep
MHKIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLT
RVFSAYGTVKSTKIIVDRAGVSKGYGFVTFETEQEAQRLQADGIT*
BS21938.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:08:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| bol-PE | 95 | CG4760-PE | 1..95 | 1..95 | 485 | 100 | Plus |
| bol-PA | 189 | CG4760-PA | 1..93 | 1..93 | 476 | 100 | Plus |
| bol-PC | 189 | CG4760-PC | 1..93 | 1..93 | 476 | 100 | Plus |
| bol-PG | 228 | CG4760-PG | 1..93 | 1..93 | 476 | 100 | Plus |
| bol-PD | 228 | CG4760-PD | 1..93 | 1..93 | 476 | 100 | Plus |
