Clone BS21944 Report

Search the DGRC for BS21944

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG42305-RA
Protein status:BS21944.pep: full length peptide match
Sequenced Size:179

Clone Sequence Records

BS21944.complete Sequence

179 bp assembled on 2011-01-25

GenBank Submission: KX805795

> BS21944.complete
GAAGTTATCAGTCGACATGAAGACACCGGACACCAAAGCCAAGTTGCTGA
ATAATATAAGTCTATCTAAACACCTGTCTTCCAAGAAAGGCGGCTCTCGC
ACTAGTAACTGCGGCAATTGTCTGGAATTCTCCGTACTCACGCGTCTCTC
CAGCGTGCCCTGAAAGCTTTCTAGACCAT

BS21944.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG42305-RC 147 CG42305-PC 1..147 17..163 735 100 Plus
CG42305-RB 147 CG42305-PB 1..147 17..163 735 100 Plus
CG42305-RA 147 CG42305-PA 1..147 17..163 735 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG42305-RC 1018 CG42305-RC 453..600 17..164 740 100 Plus
CG42305-RB 779 CG42305-RB 92..239 17..164 740 100 Plus
CG42305-RA 657 CG42305-RA 92..239 17..164 740 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18813296..18813401 59..164 530 100 Plus
2L 23513712 2L 18813100..18813143 17..60 220 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:36:46 has no hits.

BS21944.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:29 Download gff for BS21944.complete
Subject Subject Range Query Range Percent Splice Strand
CG17325-RA 91..236 17..162 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:01:09 Download gff for BS21944.complete
Subject Subject Range Query Range Percent Splice Strand
CG42305-RB 92..237 17..162 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:29 Download gff for BS21944.complete
Subject Subject Range Query Range Percent Splice Strand
CG42305-RA 92..237 17..162 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:29 Download gff for BS21944.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18813100..18813143 17..60 100 -> Plus
2L 18813298..18813399 61..162 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:01:09 Download gff for BS21944.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18813100..18813143 17..60 100 -> Plus
arm_2L 18813298..18813399 61..162 100   Plus

BS21944.pep Sequence

Translation from 16 to 162

> BS21944.pep
MKTPDTKAKLLNNISLSKHLSSKKGGSRTSNCGNCLEFSVLTRLSSVP*

BS21944.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG42305-PC 48 CG42305-PC 1..48 1..48 244 100 Plus
CG42305-PB 48 CG42305-PB 1..48 1..48 244 100 Plus
CG42305-PA 48 CG42305-PA 1..48 1..48 244 100 Plus