Clone BS21947 Report

Search the DGRC for BS21947

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptSfp87B-RA
Protein status:BS21947.pep: gold
Sequenced Size:296

Clone Sequence Records

BS21947.complete Sequence

296 bp assembled on 2011-01-25

GenBank Submission: KX804244

> BS21947.complete
GAAGTTATCAGTCGACATGCGTTTCGTATTTGTATTCGTCCTGTTATCGG
TCCTGGCTCTCAGTCTGGTTTCCGCCAAGGAACAATCAAAAACTAGCTCA
TCGCCAGGAAGGAACAATGTCGGAGCCACAGTAAACCCTCGATTGCGTCC
CAAGCGTAATATATTGTTCAATAGGCCCACCATTCGTGGTCAAGTGCAAC
GCTATATCTATGGTTATCCCTATCATAATGGGGTTCCTACGTACTACAAA
TACCCGTACTACGGCTACTTCAGGATCTAAAAGCTTTCTAGACCAT

BS21947.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp87B-RA 264 CG42485-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp87B-RA 396 CG42485-RA 48..318 10..280 1325 99.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12273173..12273443 10..280 1325 99.3 Plus
Blast to na_te.dros performed on 2014-11-26 16:36:27 has no hits.

BS21947.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:27 Download gff for BS21947.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 55..316 17..278 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:01:00 Download gff for BS21947.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 55..316 17..278 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:20 Download gff for BS21947.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 55..316 17..278 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:20 Download gff for BS21947.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12273180..12273441 17..278 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:01:00 Download gff for BS21947.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8098902..8099163 17..278 100   Plus

BS21947.pep Sequence

Translation from 16 to 279

> BS21947.pep
MRFVFVFVLLSVLALSLVSAKEQSKTSSSPGRNNVGATVNPRLRPKRNIL
FNRPTIRGQVQRYIYGYPYHNGVPTYYKYPYYGYFRI*

BS21947.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp87B-PA 87 CG42485-PA 1..87 1..87 459 100 Plus