Clone BS21948 Report

Search the DGRC for BS21948

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptCG34168-RA
Protein status:BS21948.pep: full length peptide match
Sequenced Size:215

Clone Sequence Records

BS21948.complete Sequence

215 bp assembled on 2011-01-25

GenBank Submission: KX806245

> BS21948.complete
GAAGTTATCAGTCGACATGTGCAATCCAGGAATGTGCTCGATGCCCGGCA
CTTGCTGTGGACCGACTGGCGGACTGGGACCCTGCCTGCTCTGCGGACCC
TACAATGGCCAGTGGTTCCGTTCGGTCAACCACTGTTGCGGTCCTTGTGG
CCCATATGGTTGCTGCTCATGCTACGGGCCGTATGGTGGACATTGTTAGA
AGCTTTCTAGACCAT

BS21948.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:36:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG34168-RA 183 CG34168-PA 1..183 17..199 915 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:36:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG34168-RA 492 CG34168-RA 118..300 17..199 915 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16134906..16135088 199..17 915 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:36:32 has no hits.

BS21948.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:28 Download gff for BS21948.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 83..265 17..199 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:01:03 Download gff for BS21948.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 118..300 17..199 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:23 Download gff for BS21948.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 118..300 17..199 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:23 Download gff for BS21948.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16134906..16135088 17..199 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:01:03 Download gff for BS21948.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16134906..16135088 17..199 100   Minus

BS21948.pep Sequence

Translation from 16 to 198

> BS21948.pep
MCNPGMCSMPGTCCGPTGGLGPCLLCGPYNGQWFRSVNHCCGPCGPYGCC
SCYGPYGGHC*

BS21948.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:08:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG34168-PA 60 CG34168-PA 1..60 1..60 399 100 Plus
Mst84Da-PA 63 CG17946-PA 6..57 3..60 134 46.6 Plus