BS21961.complete Sequence
305 bp assembled on 2011-01-25
GenBank Submission: KX804128
> BS21961.complete
GAAGTTATCAGTCGACATGGCCACCGCCGCAGCTGTAGCAAAAGTCGGAA
AATCAGTGCACCGCATTTTCGTGGGCAATCTACCGTGGACAGTGGGCCAC
CAGGAGTTGCGTGGCTACTTCCGCGAGTTCGGACGCGTGGTGTCCGCCAA
CGTGATCTTCGACAAGCGAACGGGGTGCTCGAAGGGCTACGGTTTCGTTA
GCTTCAACAGTTTGACCGCGCTGGAGAAGATCGAGAACGAGCAGAAGCAC
ATACTGGAGGGCAACTACCTAAACATACAGAAATCTTAGAAGCTTTCTAG
ACCAT
BS21961.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:10:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33714-RB | 273 | CG33714-PB | 1..273 | 17..289 | 1365 | 100 | Plus |
CG33714-RA | 273 | CG33714-PA | 1..273 | 17..289 | 1365 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:10:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33714-RB | 1279 | CG33714-RB | 87..361 | 16..290 | 1375 | 100 | Plus |
CG33714-RA | 1278 | CG33714-RA | 86..360 | 16..290 | 1375 | 100 | Plus |
CG33713-RB | 1278 | CG33713-RB | 86..360 | 16..290 | 1375 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:10:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 21318854..21319128 | 290..16 | 1375 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:10:10 has no hits.
BS21961.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:06 Download gff for
BS21961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33713-RB | 87..359 | 17..289 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:48:59 Download gff for
BS21961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33713-RB | 87..359 | 17..289 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:45 Download gff for
BS21961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33713-RB | 87..359 | 17..289 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:45 Download gff for
BS21961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 21318855..21319127 | 17..289 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:48:59 Download gff for
BS21961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 21189882..21190154 | 17..289 | 100 | | Minus |
BS21961.pep Sequence
Translation from 16 to 288
> BS21961.pep
MATAAAVAKVGKSVHRIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDK
RTGCSKGYGFVSFNSLTALEKIENEQKHILEGNYLNIQKS*
BS21961.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:09:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33714-PB | 90 | CG33714-PB | 1..90 | 1..90 | 466 | 100 | Plus |
CG33714-PA | 90 | CG33714-PA | 1..90 | 1..90 | 466 | 100 | Plus |
CG8021-PA | 91 | CG8021-PA | 7..85 | 12..90 | 213 | 45.6 | Plus |
Hrb98DE-PE | 360 | CG9983-PE | 113..192 | 11..90 | 156 | 33.8 | Plus |
Hrb98DE-PF | 361 | CG9983-PF | 114..193 | 11..90 | 156 | 33.8 | Plus |