Clone BS21961 Report

Search the DGRC for BS21961

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptCG33714-RA
Protein status:BS21961.pep: gold
Sequenced Size:305

Clone Sequence Records

BS21961.complete Sequence

305 bp assembled on 2011-01-25

GenBank Submission: KX804128

> BS21961.complete
GAAGTTATCAGTCGACATGGCCACCGCCGCAGCTGTAGCAAAAGTCGGAA
AATCAGTGCACCGCATTTTCGTGGGCAATCTACCGTGGACAGTGGGCCAC
CAGGAGTTGCGTGGCTACTTCCGCGAGTTCGGACGCGTGGTGTCCGCCAA
CGTGATCTTCGACAAGCGAACGGGGTGCTCGAAGGGCTACGGTTTCGTTA
GCTTCAACAGTTTGACCGCGCTGGAGAAGATCGAGAACGAGCAGAAGCAC
ATACTGGAGGGCAACTACCTAAACATACAGAAATCTTAGAAGCTTTCTAG
ACCAT

BS21961.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG33714-RB 273 CG33714-PB 1..273 17..289 1365 100 Plus
CG33714-RA 273 CG33714-PA 1..273 17..289 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG33714-RB 1279 CG33714-RB 87..361 16..290 1375 100 Plus
CG33714-RA 1278 CG33714-RA 86..360 16..290 1375 100 Plus
CG33713-RB 1278 CG33713-RB 86..360 16..290 1375 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21318854..21319128 290..16 1375 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:10:10 has no hits.

BS21961.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:06 Download gff for BS21961.complete
Subject Subject Range Query Range Percent Splice Strand
CG33713-RB 87..359 17..289 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:48:59 Download gff for BS21961.complete
Subject Subject Range Query Range Percent Splice Strand
CG33713-RB 87..359 17..289 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:45 Download gff for BS21961.complete
Subject Subject Range Query Range Percent Splice Strand
CG33713-RB 87..359 17..289 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:45 Download gff for BS21961.complete
Subject Subject Range Query Range Percent Splice Strand
X 21318855..21319127 17..289 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:48:59 Download gff for BS21961.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 21189882..21190154 17..289 100   Minus

BS21961.pep Sequence

Translation from 16 to 288

> BS21961.pep
MATAAAVAKVGKSVHRIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDK
RTGCSKGYGFVSFNSLTALEKIENEQKHILEGNYLNIQKS*

BS21961.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG33714-PB 90 CG33714-PB 1..90 1..90 466 100 Plus
CG33714-PA 90 CG33714-PA 1..90 1..90 466 100 Plus
CG8021-PA 91 CG8021-PA 7..85 12..90 213 45.6 Plus
Hrb98DE-PE 360 CG9983-PE 113..192 11..90 156 33.8 Plus
Hrb98DE-PF 361 CG9983-PF 114..193 11..90 156 33.8 Plus