Clone BS21964 Report

Search the DGRC for BS21964

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG18624-RA
Protein status:BS21964.pep: full length peptide match
Sequenced Size:203

Clone Sequence Records

BS21964.complete Sequence

203 bp assembled on 2011-01-25

GenBank Submission: KX801792

> BS21964.complete
GAAGTTATCAGTCGACATGGTCTTGGGACTGGATAAGCGAGCACTGTGGG
GCGCGTTGCCCCTGCTGGGATTTGCCATTGGCCACTTCCTGGACAAGAAG
GAAACGGAACGTATGACCATGTTCCGGGACAAGAGTGCCCTATACGGCCG
TCCCGCCGGCAGCGAGGGTAAGGCGCCATCCTGGTAGAAGCTTTCTAGAC
CAT

BS21964.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG18624-RD 171 CG18624-PD 1..171 17..187 855 100 Plus
CG18624-RC 171 CG18624-PC 1..171 17..187 855 100 Plus
CG18624-RE 171 CG18624-PE 1..171 17..187 855 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG18624-RD 649 CG18624-RD 401..572 16..187 860 100 Plus
CG18624-RC 413 CG18624-RC 165..336 16..187 860 100 Plus
CG18624-RE 575 CG18624-RE 327..498 16..187 860 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:10:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7893130..7893301 187..16 860 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:10:49 has no hits.

BS21964.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:07 Download gff for BS21964.complete
Subject Subject Range Query Range Percent Splice Strand
CG18624-RB 262..432 17..187 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:10 Download gff for BS21964.complete
Subject Subject Range Query Range Percent Splice Strand
CG18624-RE 328..498 17..187 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:58 Download gff for BS21964.complete
Subject Subject Range Query Range Percent Splice Strand
CG18624-RE 328..498 17..187 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:58 Download gff for BS21964.complete
Subject Subject Range Query Range Percent Splice Strand
X 7893130..7893300 17..187 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:10 Download gff for BS21964.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7787163..7787333 17..187 100   Minus

BS21964.pep Sequence

Translation from 16 to 186

> BS21964.pep
MVLGLDKRALWGALPLLGFAIGHFLDKKETERMTMFRDKSALYGRPAGSE
GKAPSW*

BS21964.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG18624-PD 56 CG18624-PD 1..56 1..56 297 100 Plus
CG18624-PC 56 CG18624-PC 1..56 1..56 297 100 Plus
CG18624-PE 56 CG18624-PE 1..56 1..56 297 100 Plus
CG18624-PB 56 CG18624-PB 1..56 1..56 297 100 Plus
CG18624-PA 56 CG18624-PA 1..56 1..56 297 100 Plus