BS21964.complete Sequence
203 bp assembled on 2011-01-25
GenBank Submission: KX801792
> BS21964.complete
GAAGTTATCAGTCGACATGGTCTTGGGACTGGATAAGCGAGCACTGTGGG
GCGCGTTGCCCCTGCTGGGATTTGCCATTGGCCACTTCCTGGACAAGAAG
GAAACGGAACGTATGACCATGTTCCGGGACAAGAGTGCCCTATACGGCCG
TCCCGCCGGCAGCGAGGGTAAGGCGCCATCCTGGTAGAAGCTTTCTAGAC
CAT
BS21964.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:10:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18624-RD | 171 | CG18624-PD | 1..171 | 17..187 | 855 | 100 | Plus |
CG18624-RC | 171 | CG18624-PC | 1..171 | 17..187 | 855 | 100 | Plus |
CG18624-RE | 171 | CG18624-PE | 1..171 | 17..187 | 855 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:10:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18624-RD | 649 | CG18624-RD | 401..572 | 16..187 | 860 | 100 | Plus |
CG18624-RC | 413 | CG18624-RC | 165..336 | 16..187 | 860 | 100 | Plus |
CG18624-RE | 575 | CG18624-RE | 327..498 | 16..187 | 860 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:10:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7893130..7893301 | 187..16 | 860 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:10:49 has no hits.
BS21964.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:07 Download gff for
BS21964.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18624-RB | 262..432 | 17..187 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:10 Download gff for
BS21964.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18624-RE | 328..498 | 17..187 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:07:58 Download gff for
BS21964.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18624-RE | 328..498 | 17..187 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:07:58 Download gff for
BS21964.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7893130..7893300 | 17..187 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:10 Download gff for
BS21964.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 7787163..7787333 | 17..187 | 100 | | Minus |
BS21964.pep Sequence
Translation from 16 to 186
> BS21964.pep
MVLGLDKRALWGALPLLGFAIGHFLDKKETERMTMFRDKSALYGRPAGSE
GKAPSW*
BS21964.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:09:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18624-PD | 56 | CG18624-PD | 1..56 | 1..56 | 297 | 100 | Plus |
CG18624-PC | 56 | CG18624-PC | 1..56 | 1..56 | 297 | 100 | Plus |
CG18624-PE | 56 | CG18624-PE | 1..56 | 1..56 | 297 | 100 | Plus |
CG18624-PB | 56 | CG18624-PB | 1..56 | 1..56 | 297 | 100 | Plus |
CG18624-PA | 56 | CG18624-PA | 1..56 | 1..56 | 297 | 100 | Plus |