Clone BS21967 Report

Search the DGRC for BS21967

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptCG34200-RA
Protein status:BS21967.pep: full length peptide match
Sequenced Size:191

Clone Sequence Records

BS21967.complete Sequence

191 bp assembled on 2011-01-25

GenBank Submission: KX805705

> BS21967.complete
GAAGTTATCAGTCGACATGGTAAAGTCTTCAAATCCCCTGAGCATCGTGC
GCAGCATTTACAACAACGAATTTCAATGGATGCTGGTCAAGAGCTACGGA
CTTTTCTTCTTGGGAGTGCGTTTGGCCAAGGAGTTCGTGGGTGTCGAACT
GATGCCGTCGCTGGGGCCAGCCTAAAAGCTTTCTAGACCAT

BS21967.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34200-RA 159 CG34200-PA 1..159 17..175 780 99.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG34200-RA 321 CG34200-RA 103..261 17..175 780 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5757910..5758007 78..175 490 100 Plus
2R 25286936 2R 5757764..5757826 17..79 300 98.4 Plus
Blast to na_te.dros performed on 2014-11-26 15:11:19 has no hits.

BS21967.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:08 Download gff for BS21967.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 72..228 17..173 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:22 Download gff for BS21967.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 103..259 17..173 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:08 Download gff for BS21967.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 103..259 17..173 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:08 Download gff for BS21967.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5757764..5757825 17..78 98 -> Plus
2R 5757911..5758005 79..173 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:22 Download gff for BS21967.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1645269..1645330 17..78 98 -> Plus
arm_2R 1645416..1645510 79..173 100   Plus

BS21967.pep Sequence

Translation from 16 to 174

> BS21967.pep
MVKSSNPLSIVRSIYNNEFQWMLVKSYGLFFLGVRLAKEFVGVELMPSLG
PA*

BS21967.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34200-PA 52 CG34200-PA 1..52 1..52 264 100 Plus