BS21967.complete Sequence
191 bp assembled on 2011-01-25
GenBank Submission: KX805705
> BS21967.complete
GAAGTTATCAGTCGACATGGTAAAGTCTTCAAATCCCCTGAGCATCGTGC
GCAGCATTTACAACAACGAATTTCAATGGATGCTGGTCAAGAGCTACGGA
CTTTTCTTCTTGGGAGTGCGTTTGGCCAAGGAGTTCGTGGGTGTCGAACT
GATGCCGTCGCTGGGGCCAGCCTAAAAGCTTTCTAGACCAT
BS21967.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:11:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34200-RA | 159 | CG34200-PA | 1..159 | 17..175 | 780 | 99.4 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:11:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34200-RA | 321 | CG34200-RA | 103..261 | 17..175 | 780 | 99.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:11:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 5757910..5758007 | 78..175 | 490 | 100 | Plus |
2R | 25286936 | 2R | 5757764..5757826 | 17..79 | 300 | 98.4 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:11:19 has no hits.
BS21967.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:08 Download gff for
BS21967.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34200-RA | 72..228 | 17..173 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:22 Download gff for
BS21967.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34200-RA | 103..259 | 17..173 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:08 Download gff for
BS21967.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34200-RA | 103..259 | 17..173 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:08 Download gff for
BS21967.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 5757764..5757825 | 17..78 | 98 | -> | Plus |
2R | 5757911..5758005 | 79..173 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:22 Download gff for
BS21967.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 1645269..1645330 | 17..78 | 98 | -> | Plus |
arm_2R | 1645416..1645510 | 79..173 | 100 | | Plus |
BS21967.pep Sequence
Translation from 16 to 174
> BS21967.pep
MVKSSNPLSIVRSIYNNEFQWMLVKSYGLFFLGVRLAKEFVGVELMPSLG
PA*
BS21967.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:06:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34200-PA | 52 | CG34200-PA | 1..52 | 1..52 | 264 | 100 | Plus |