Clone BS21968 Report

Search the DGRC for BS21968

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG34117-RA
Protein status:BS21968.pep: gold
Sequenced Size:338

Clone Sequence Records

BS21968.complete Sequence

338 bp assembled on 2011-01-25

GenBank Submission: KX806553

> BS21968.complete
GAAGTTATCAGTCGACATGGCGGGAACCAAGGTGCTGCGCTCCCTGCTGC
ACGAATTGCGCCAGGCATCTCCAAATGGCTGCATCAAGGACTCTCTGGCC
GCGCGCTACATTTTGGCGCAATACAAGAAGTTCGCCACCACGGAGCAACA
ATTCTGCAAGGCGCGCAACGAAGCGACTTTCCTGGGTCAAACCTACCTGA
CCTACCTAGCCAGCCAGCGCCGGTACTTGGAGCTCTACAAGGAATATCAC
GGAAGGGGCGAGAGATCCGTAAGGGATACCGCCGATTTGGTGGGCTTCAA
GCTGCCCTCGGATCCCAAGTGAAAGCTTTCTAGACCAT

BS21968.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG34117-RA 306 CG34117-PA 1..306 17..322 1515 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG34117-RA 428 CG34117-RA 59..364 17..322 1515 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9399634..9399939 322..17 1515 99.7 Minus
Blast to na_te.dros performed on 2014-11-26 15:46:38 has no hits.

BS21968.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:38 Download gff for BS21968.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 55..359 17..321 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:37 Download gff for BS21968.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 59..363 17..321 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:20:03 Download gff for BS21968.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 59..363 17..321 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:03 Download gff for BS21968.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9399635..9399939 17..321 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:37 Download gff for BS21968.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5225357..5225661 17..321 99   Minus

BS21968.pep Sequence

Translation from 16 to 321

> BS21968.pep
MAGTKVLRSLLHELRQASPNGCIKDSLAARYILAQYKKFATTEQQFCKAR
NEATFLGQTYLTYLASQRRYLELYKEYHGRGERSVRDTADLVGFKLPSDP
K*

BS21968.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG34117-PA 101 CG34117-PA 1..101 1..101 521 100 Plus