Clone BS21975 Report

Search the DGRC for BS21975

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptVm32E-RA
Protein status:BS21975.pep: gold
Sequenced Size:402

Clone Sequence Records

BS21975.complete Sequence

402 bp assembled on 2011-01-25

GenBank Submission: KX804121

> BS21975.complete
GAAGTTATCAGTCGACATGCAGATCGTTGCTCTCACCCTCGTTGCGTTTG
TGGCCATTGCCGGTGCCTCCTGCCCGTATGCAGCTCCAGCTCCAGCTTAT
TCAGCGCCCGCTGCTTCTTCTGGCTACCCGGCTCCACCATGCCCCACCAA
CTACCTGTTCAGCTGCCAGCCCAATTTGGCCCCAGCTCCTTGTGCCCAGG
AGGCCCCAGCCTATGGATCCGCCGGCGCCTACACAGAACAGGTGCCCCAC
TACGTGGGAAGTCCCAACCGAGAGCAGTTGCAGCAATTTCACCAGCGCAT
TGGAATGGCGGCTTTGATGGAGGAACTGCGCGGCTTGGGCCAAGGAATCC
AGGGTCAACAGTACTAGAAGCTTTCTAGACCATTCGTGGGCGCCTCTATG
GG

BS21975.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
Vm32E-RB 351 CG16874-PB 1..351 17..367 1755 100 Plus
Vm32E-RA 351 CG16874-PA 1..351 17..367 1755 100 Plus
Vm34Ca-RA 360 CG9271-PA 210..268 127..185 205 89.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
Vm32E-RB 499 CG16874-RB 31..382 16..367 1760 100 Plus
Vm32E-RA 437 CG16874-RA 31..382 16..367 1760 100 Plus
Vm34Ca-RA 491 CG9271-RA 256..314 127..185 205 89.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11171284..11171635 367..16 1760 100 Minus
2L 23513712 2L 13411318..13411376 185..127 205 89.8 Minus
Blast to na_te.dros performed 2014-11-26 15:12:38
Subject Length Description Subject Range Query Range Score Percent Strand
TART-C 11124 TART-C TARTC 11124bp 8764..8859 101..8 115 59.4 Minus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 7311..7369 101..43 106 64.4 Minus

BS21975.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:12 Download gff for BS21975.complete
Subject Subject Range Query Range Percent Splice Strand
Vm32E-RA 32..386 17..371 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:43 Download gff for BS21975.complete
Subject Subject Range Query Range Percent Splice Strand
Vm32E-RA 32..386 17..371 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:40 Download gff for BS21975.complete
Subject Subject Range Query Range Percent Splice Strand
Vm32E-RA 32..386 17..371 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:40 Download gff for BS21975.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11171280..11171634 17..371 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:43 Download gff for BS21975.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11171280..11171634 17..371 99   Minus

BS21975.pep Sequence

Translation from 16 to 366

> BS21975.pep
MQIVALTLVAFVAIAGASCPYAAPAPAYSAPAASSGYPAPPCPTNYLFSC
QPNLAPAPCAQEAPAYGSAGAYTEQVPHYVGSPNREQLQQFHQRIGMAAL
MEELRGLGQGIQGQQY*

BS21975.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Vm32E-PB 116 CG16874-PB 1..116 1..116 616 100 Plus
Vm32E-PA 116 CG16874-PA 1..116 1..116 616 100 Plus
Vm34Ca-PA 119 CG9271-PA 33..116 16..83 227 53.6 Plus
Vm26Ab-PB 168 CG9046-PB 90..160 15..79 211 59.2 Plus
Vm26Ab-PA 168 CG9046-PA 90..160 15..79 211 59.2 Plus