Clone BS21982 Report

Search the DGRC for BS21982

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:82
Vector:pDNR-Dual
Associated Gene/Transcriptksh-RB
Protein status:BS21982.pep: full length peptide match
Sequenced Size:251

Clone Sequence Records

BS21982.complete Sequence

251 bp assembled on 2011-01-25

GenBank Submission: KX803489

> BS21982.complete
GAAGTTATCAGTCGACATGAGCGCCCTGTTCAACTTCCACAGCCTGCTGT
CGGTCATCCTGCTGCTGATCTGCACCTGTGCCTACCTGCGCTCGCTCTTC
CCCAGCTTGATAGACCGCAACAAGACCGGATTCATGGGCACCTTCTGGAA
GCTGGCAAGGATTGGGGAGCGCAAGTCGCCGTGGGTAGGAGCCGCCTGCC
TGATCATGGCCTTCACCGTTCTCTTTTGGAGCTGAAAGCTTTCTAGACCA
T

BS21982.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:47:36
Subject Length Description Subject Range Query Range Score Percent Strand
ksh-RB 219 CG14199-PB 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
ksh-RB 435 CG14199-RB 90..309 16..235 1100 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19494727..19494837 129..19 555 100 Minus
X 23542271 X 19494546..19494652 235..129 535 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:47:35 has no hits.

BS21982.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:39 Download gff for BS21982.complete
Subject Subject Range Query Range Percent Splice Strand
ksh-RB 77..294 17..234 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:49 Download gff for BS21982.complete
Subject Subject Range Query Range Percent Splice Strand
ksh-RB 91..308 17..234 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:20:21 Download gff for BS21982.complete
Subject Subject Range Query Range Percent Splice Strand
ksh-RB 91..308 17..234 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:21 Download gff for BS21982.complete
Subject Subject Range Query Range Percent Splice Strand
X 19494547..19494651 130..234 100 <- Minus
X 19494727..19494838 17..129 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:49 Download gff for BS21982.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19388580..19388684 130..234 100 <- Minus
arm_X 19388760..19388871 17..129 99   Minus

BS21982.pep Sequence

Translation from 16 to 234

> BS21982.pep
MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIG
ERKSPWVGAACLIMAFTVLFWS*

BS21982.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
ksh-PB 72 CG14199-PB 1..72 1..72 380 100 Plus