BS21982.complete Sequence
251 bp assembled on 2011-01-25
GenBank Submission: KX803489
> BS21982.complete
GAAGTTATCAGTCGACATGAGCGCCCTGTTCAACTTCCACAGCCTGCTGT
CGGTCATCCTGCTGCTGATCTGCACCTGTGCCTACCTGCGCTCGCTCTTC
CCCAGCTTGATAGACCGCAACAAGACCGGATTCATGGGCACCTTCTGGAA
GCTGGCAAGGATTGGGGAGCGCAAGTCGCCGTGGGTAGGAGCCGCCTGCC
TGATCATGGCCTTCACCGTTCTCTTTTGGAGCTGAAAGCTTTCTAGACCA
T
BS21982.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:47:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ksh-RB | 219 | CG14199-PB | 1..219 | 17..235 | 1095 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:47:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ksh-RB | 435 | CG14199-RB | 90..309 | 16..235 | 1100 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:47:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 19494727..19494837 | 129..19 | 555 | 100 | Minus |
X | 23542271 | X | 19494546..19494652 | 235..129 | 535 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:47:35 has no hits.
BS21982.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:39 Download gff for
BS21982.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ksh-RB | 77..294 | 17..234 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:49 Download gff for
BS21982.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ksh-RB | 91..308 | 17..234 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:20:21 Download gff for
BS21982.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ksh-RB | 91..308 | 17..234 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:21 Download gff for
BS21982.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19494547..19494651 | 130..234 | 100 | <- | Minus |
X | 19494727..19494838 | 17..129 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:49 Download gff for
BS21982.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 19388580..19388684 | 130..234 | 100 | <- | Minus |
arm_X | 19388760..19388871 | 17..129 | 99 | | Minus |
BS21982.pep Sequence
Translation from 16 to 234
> BS21982.pep
MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIG
ERKSPWVGAACLIMAFTVLFWS*
BS21982.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ksh-PB | 72 | CG14199-PB | 1..72 | 1..72 | 380 | 100 | Plus |