Clone BS21983 Report

Search the DGRC for BS21983

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:83
Vector:pDNR-Dual
Associated Gene/TranscriptVhaM9.7-d-RA
Protein status:BS21983.pep: gold
Sequenced Size:299

Clone Sequence Records

BS21983.complete Sequence

299 bp assembled on 2011-01-25

GenBank Submission: KX800292

> BS21983.complete
GAAGTTATCAGTCGACATGGATAAGCACGTGGCATTCATGGTCATCACCG
TTTTCTGGCTACTATTCGCCATCATTGGGTTCCTGGTGTCCTACCGATAC
GAGGAGCGTGGTCTAATCCGGTGCTGTGTGATCCTAACGGCTGTATGCTG
CTACTTGGCCTGGATGGTCACCTTCGTGATGCAGTTGAATCCACTGACCG
GACCGCGAGCCAAACAGAAGATTATCCTCGGCATGATAACCTACTGGCCC
AGGTCCATTATCCACGATGAAAAGGACCCATAGAAGCTTTCTAGACCAT

BS21983.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-d-RA 267 CG14909-PA 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-d-RA 494 CG14909-RA 15..283 17..285 1345 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16975218..16975486 17..285 1345 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:11:43 has no hits.

BS21983.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:10 Download gff for BS21983.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-d-RA 15..281 17..283 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:29 Download gff for BS21983.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-d-RA 15..281 17..283 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:17 Download gff for BS21983.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-d-RA 15..281 17..283 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:17 Download gff for BS21983.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16975218..16975484 17..283 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:29 Download gff for BS21983.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12800940..12801206 17..283 100   Plus

BS21983.pep Sequence

Translation from 16 to 282

> BS21983.pep
MDKHVAFMVITVFWLLFAIIGFLVSYRYEERGLIRCCVILTAVCCYLAWM
VTFVMQLNPLTGPRAKQKIILGMITYWPRSIIHDEKDP*

BS21983.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-d-PA 88 CG14909-PA 1..88 1..88 475 100 Plus
VhaM9.7-b-PB 89 CG7625-PB 6..81 5..81 141 39.2 Plus
VhaM9.7-b-PA 89 CG7625-PA 6..81 5..81 141 39.2 Plus
VhaM9.7-c-PA 84 CG11589-PA 1..81 1..81 134 32.1 Plus
VhaM9.7-a-PC 85 CG1268-PC 4..83 6..82 133 31.2 Plus