BS21983.complete Sequence
299 bp assembled on 2011-01-25
GenBank Submission: KX800292
> BS21983.complete
GAAGTTATCAGTCGACATGGATAAGCACGTGGCATTCATGGTCATCACCG
TTTTCTGGCTACTATTCGCCATCATTGGGTTCCTGGTGTCCTACCGATAC
GAGGAGCGTGGTCTAATCCGGTGCTGTGTGATCCTAACGGCTGTATGCTG
CTACTTGGCCTGGATGGTCACCTTCGTGATGCAGTTGAATCCACTGACCG
GACCGCGAGCCAAACAGAAGATTATCCTCGGCATGATAACCTACTGGCCC
AGGTCCATTATCCACGATGAAAAGGACCCATAGAAGCTTTCTAGACCAT
BS21983.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:11:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-d-RA | 267 | CG14909-PA | 1..267 | 17..283 | 1335 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:11:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-d-RA | 494 | CG14909-RA | 15..283 | 17..285 | 1345 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:11:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 16975218..16975486 | 17..285 | 1345 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:11:43 has no hits.
BS21983.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:10 Download gff for
BS21983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-d-RA | 15..281 | 17..283 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:29 Download gff for
BS21983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-d-RA | 15..281 | 17..283 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:17 Download gff for
BS21983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-d-RA | 15..281 | 17..283 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:17 Download gff for
BS21983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 16975218..16975484 | 17..283 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:29 Download gff for
BS21983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 12800940..12801206 | 17..283 | 100 | | Plus |
BS21983.pep Sequence
Translation from 16 to 282
> BS21983.pep
MDKHVAFMVITVFWLLFAIIGFLVSYRYEERGLIRCCVILTAVCCYLAWM
VTFVMQLNPLTGPRAKQKIILGMITYWPRSIIHDEKDP*
BS21983.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:10:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-d-PA | 88 | CG14909-PA | 1..88 | 1..88 | 475 | 100 | Plus |
VhaM9.7-b-PB | 89 | CG7625-PB | 6..81 | 5..81 | 141 | 39.2 | Plus |
VhaM9.7-b-PA | 89 | CG7625-PA | 6..81 | 5..81 | 141 | 39.2 | Plus |
VhaM9.7-c-PA | 84 | CG11589-PA | 1..81 | 1..81 | 134 | 32.1 | Plus |
VhaM9.7-a-PC | 85 | CG1268-PC | 4..83 | 6..82 | 133 | 31.2 | Plus |