Clone BS21984 Report

Search the DGRC for BS21984

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:84
Vector:pDNR-Dual
Associated Gene/TranscriptSfp33A3-RA
Protein status:BS21984.pep: gold
Sequenced Size:332

Clone Sequence Records

BS21984.complete Sequence

332 bp assembled on 2011-01-25

GenBank Submission: KX801317

> BS21984.complete
GAAGTTATCAGTCGACATGCGATACCTGCCCTTTATCGCATTTTTCCTGT
TTGCTCTTCTGGCCCTGTCTGTGGGCGAGGAATTTTGCAATTGTAATCTT
ATCTATAGACCATTGTGCGCATCGAACTCCAAGACCTATAACAACTACTG
TGAATTCAAGTGTGAAGTTAAAAGGGGAAGCCCCATAACAGTGGTAAAAT
GGAAACAGTGCAATGAAAGTGCGGGGAAAATAAAGATAGATTGCCAATTG
CCTATAAACTTACAGTTGTGTAAAAGTATAAAATCTAATCGAAAAGATCC
AATCGCTATAGCTTAAAAGCTTTCTAGACCAT

BS21984.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A3-RA 300 CG42474-PA 1..300 17..316 1500 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A3-RA 418 CG42474-RA 23..324 16..317 1510 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11839934..11840235 16..317 1510 100 Plus
Blast to na_te.dros performed 2014-11-26 15:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
accord 7404 accord ACCORD 7404bp 1376..1412 113..77 113 78.4 Minus

BS21984.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:11 Download gff for BS21984.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 24..321 17..314 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:32 Download gff for BS21984.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 24..321 17..314 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:20 Download gff for BS21984.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 24..321 17..314 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:20 Download gff for BS21984.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11839935..11840232 17..314 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:32 Download gff for BS21984.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11839935..11840232 17..314 100   Plus

BS21984.pep Sequence

Translation from 16 to 315

> BS21984.pep
MRYLPFIAFFLFALLALSVGEEFCNCNLIYRPLCASNSKTYNNYCEFKCE
VKRGSPITVVKWKQCNESAGKIKIDCQLPINLQLCKSIKSNRKDPIAIA*

BS21984.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A3-PA 99 CG42474-PA 1..99 1..99 533 100 Plus
CG31704-PB 68 CG31704-PB 1..68 1..65 153 50 Plus
CG31704-PA 68 CG31704-PA 1..68 1..65 153 50 Plus