BS21984.complete Sequence
332 bp assembled on 2011-01-25
GenBank Submission: KX801317
> BS21984.complete
GAAGTTATCAGTCGACATGCGATACCTGCCCTTTATCGCATTTTTCCTGT
TTGCTCTTCTGGCCCTGTCTGTGGGCGAGGAATTTTGCAATTGTAATCTT
ATCTATAGACCATTGTGCGCATCGAACTCCAAGACCTATAACAACTACTG
TGAATTCAAGTGTGAAGTTAAAAGGGGAAGCCCCATAACAGTGGTAAAAT
GGAAACAGTGCAATGAAAGTGCGGGGAAAATAAAGATAGATTGCCAATTG
CCTATAAACTTACAGTTGTGTAAAAGTATAAAATCTAATCGAAAAGATCC
AATCGCTATAGCTTAAAAGCTTTCTAGACCAT
BS21984.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:11:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A3-RA | 300 | CG42474-PA | 1..300 | 17..316 | 1500 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:11:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A3-RA | 418 | CG42474-RA | 23..324 | 16..317 | 1510 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:11:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11839934..11840235 | 16..317 | 1510 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 15:11:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
accord | 7404 | accord ACCORD 7404bp | 1376..1412 | 113..77 | 113 | 78.4 | Minus |
BS21984.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:11 Download gff for
BS21984.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A3-RA | 24..321 | 17..314 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:32 Download gff for
BS21984.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A3-RA | 24..321 | 17..314 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:20 Download gff for
BS21984.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A3-RA | 24..321 | 17..314 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:20 Download gff for
BS21984.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11839935..11840232 | 17..314 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:32 Download gff for
BS21984.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11839935..11840232 | 17..314 | 100 | | Plus |
BS21984.pep Sequence
Translation from 16 to 315
> BS21984.pep
MRYLPFIAFFLFALLALSVGEEFCNCNLIYRPLCASNSKTYNNYCEFKCE
VKRGSPITVVKWKQCNESAGKIKIDCQLPINLQLCKSIKSNRKDPIAIA*
BS21984.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:10:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A3-PA | 99 | CG42474-PA | 1..99 | 1..99 | 533 | 100 | Plus |
CG31704-PB | 68 | CG31704-PB | 1..68 | 1..65 | 153 | 50 | Plus |
CG31704-PA | 68 | CG31704-PA | 1..68 | 1..65 | 153 | 50 | Plus |