Clone BS21986 Report

Search the DGRC for BS21986

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:86
Vector:pDNR-Dual
Associated Gene/TranscriptCG2816-RB
Protein status:BS21986.pep: full length peptide match
Sequenced Size:287

Clone Sequence Records

BS21986.complete Sequence

287 bp assembled on 2011-01-25

GenBank Submission: KX805933

> BS21986.complete
GAAGTTATCAGTCGACATGATGCCGGCTTATTGGCAGTGGCTTTTGGTTG
GCCTCCTCCTGTTGATTCCGCACCATTCAGGGGCGGCCTCCAAGAGAGTG
AAACTATGCCTGCAGCCCATGATCAGTGGTCGGTGCTTTGGATACGTTGA
GAGCTATGCCTACAATCCCATTAAGCGCCATTGCGAACCCTTCATCTACG
GCGGATGCGGCGGTAATGACAATCGATTTAGTACCAAAGCTGAGTGCGAG
TTCAACTGCCGTGATATTTGAAAGCTTTCTAGACCAT

BS21986.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG2816-RB 255 CG2816-PB 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG2816-RB 542 CG2816-RB 72..327 16..271 1280 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3703864..3704038 97..271 875 100 Plus
2L 23513712 2L 3703730..3703812 16..98 415 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:13:44 has no hits.

BS21986.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:14 Download gff for BS21986.complete
Subject Subject Range Query Range Percent Splice Strand
CG2816-RB 73..326 17..270 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:58 Download gff for BS21986.complete
Subject Subject Range Query Range Percent Splice Strand
CG2816-RB 73..326 17..270 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:05 Download gff for BS21986.complete
Subject Subject Range Query Range Percent Splice Strand
CG2816-RB 73..326 17..270 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:05 Download gff for BS21986.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3703731..3703812 17..98 100 -> Plus
2L 3703866..3704037 99..270 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:58 Download gff for BS21986.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3703731..3703812 17..98 100 -> Plus
arm_2L 3703866..3704037 99..270 100   Plus

BS21986.pep Sequence

Translation from 16 to 270

> BS21986.pep
MMPAYWQWLLVGLLLLIPHHSGAASKRVKLCLQPMISGRCFGYVESYAYN
PIKRHCEPFIYGGCGGNDNRFSTKAECEFNCRDI*

BS21986.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG2816-PB 84 CG2816-PB 1..84 1..84 477 100 Plus
CG3604-PB 132 CG3604-PB 55..105 31..81 152 51 Plus
CG3604-PA 132 CG3604-PA 55..105 31..81 152 51 Plus
CG16712-PB 82 CG16712-PB 38..82 39..83 146 48.9 Plus
CG16712-PA 82 CG16712-PA 38..82 39..83 146 48.9 Plus