BS21986.complete Sequence
287 bp assembled on 2011-01-25
GenBank Submission: KX805933
> BS21986.complete
GAAGTTATCAGTCGACATGATGCCGGCTTATTGGCAGTGGCTTTTGGTTG
GCCTCCTCCTGTTGATTCCGCACCATTCAGGGGCGGCCTCCAAGAGAGTG
AAACTATGCCTGCAGCCCATGATCAGTGGTCGGTGCTTTGGATACGTTGA
GAGCTATGCCTACAATCCCATTAAGCGCCATTGCGAACCCTTCATCTACG
GCGGATGCGGCGGTAATGACAATCGATTTAGTACCAAAGCTGAGTGCGAG
TTCAACTGCCGTGATATTTGAAAGCTTTCTAGACCAT
BS21986.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:13:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG2816-RB | 255 | CG2816-PB | 1..255 | 17..271 | 1275 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:13:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG2816-RB | 542 | CG2816-RB | 72..327 | 16..271 | 1280 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:13:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3703864..3704038 | 97..271 | 875 | 100 | Plus |
2L | 23513712 | 2L | 3703730..3703812 | 16..98 | 415 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:13:44 has no hits.
BS21986.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:14 Download gff for
BS21986.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2816-RB | 73..326 | 17..270 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:58 Download gff for
BS21986.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2816-RB | 73..326 | 17..270 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:05 Download gff for
BS21986.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2816-RB | 73..326 | 17..270 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:05 Download gff for
BS21986.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3703731..3703812 | 17..98 | 100 | -> | Plus |
2L | 3703866..3704037 | 99..270 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:58 Download gff for
BS21986.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3703731..3703812 | 17..98 | 100 | -> | Plus |
arm_2L | 3703866..3704037 | 99..270 | 100 | | Plus |
BS21986.pep Sequence
Translation from 16 to 270
> BS21986.pep
MMPAYWQWLLVGLLLLIPHHSGAASKRVKLCLQPMISGRCFGYVESYAYN
PIKRHCEPFIYGGCGGNDNRFSTKAECEFNCRDI*
BS21986.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:10:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG2816-PB | 84 | CG2816-PB | 1..84 | 1..84 | 477 | 100 | Plus |
CG3604-PB | 132 | CG3604-PB | 55..105 | 31..81 | 152 | 51 | Plus |
CG3604-PA | 132 | CG3604-PA | 55..105 | 31..81 | 152 | 51 | Plus |
CG16712-PB | 82 | CG16712-PB | 38..82 | 39..83 | 146 | 48.9 | Plus |
CG16712-PA | 82 | CG16712-PA | 38..82 | 39..83 | 146 | 48.9 | Plus |