Clone BS21989 Report

Search the DGRC for BS21989

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptVhaM9.7-a-RB
Protein status:BS21989.pep: gold
Sequenced Size:290

Clone Sequence Records

BS21989.complete Sequence

290 bp assembled on 2011-01-25

GenBank Submission: KX801166

> BS21989.complete
GAAGTTATCAGTCGACATGGGTGCCGCTTTCTTTCCCGTGCTGTTTTTCA
CCGCCTTGTGGGGCGGTGTGGGCATCGCCATGCCCATAATGACCCCCAAA
GGACCTCACCAGAATCTGATCCGCTGCATCCTGATGCTGACCGCCGCCTG
CTGCTGGCTCTTCTGGCTATGTTGCTACATGGCCCAAATGAATCCCTTGA
TCGGGCCCAAACTAAAGCGCGATGTGGTGGCCATGATTGGAAGGTCCTGG
AACAACCCAATTGTGGCTGGTTAGAAGCTTTCTAGACCAT

BS21989.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-a-RC 258 CG1268-PC 1..258 17..274 1290 100 Plus
VhaM9.7-a-RB 258 CG1268-PB 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-a-RC 710 CG1268-RC 60..317 17..274 1290 100 Plus
VhaM9.7-a-RB 471 CG1268-RB 52..309 17..274 1290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4262814..4263071 17..274 1290 100 Plus
Blast to na_te.dros performed 2014-11-26 15:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
GATE 8507 GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). 8165..8210 133..178 113 71.7 Plus

BS21989.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:14 Download gff for BS21989.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-a-RC 63..320 17..274 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:03 Download gff for BS21989.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-a-RB 52..309 17..274 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:11 Download gff for BS21989.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-a-RB 52..309 17..274 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:11 Download gff for BS21989.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4262814..4263071 17..274 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:03 Download gff for BS21989.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4262814..4263071 17..274 100   Plus

BS21989.pep Sequence

Translation from 16 to 273

> BS21989.pep
MGAAFFPVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFW
LCCYMAQMNPLIGPKLKRDVVAMIGRSWNNPIVAG*

BS21989.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-a-PC 85 CG1268-PC 1..85 1..85 475 100 Plus
VhaM9.7-a-PB 85 CG1268-PB 1..85 1..85 475 100 Plus
VhaM9.7-c-PA 84 CG11589-PA 4..84 5..85 264 53.1 Plus
VhaM9.7-b-PB 89 CG7625-PB 9..81 9..82 226 50 Plus
VhaM9.7-b-PA 89 CG7625-PA 9..81 9..82 226 50 Plus