BS21989.complete Sequence
290 bp assembled on 2011-01-25
GenBank Submission: KX801166
> BS21989.complete
GAAGTTATCAGTCGACATGGGTGCCGCTTTCTTTCCCGTGCTGTTTTTCA
CCGCCTTGTGGGGCGGTGTGGGCATCGCCATGCCCATAATGACCCCCAAA
GGACCTCACCAGAATCTGATCCGCTGCATCCTGATGCTGACCGCCGCCTG
CTGCTGGCTCTTCTGGCTATGTTGCTACATGGCCCAAATGAATCCCTTGA
TCGGGCCCAAACTAAAGCGCGATGTGGTGGCCATGATTGGAAGGTCCTGG
AACAACCCAATTGTGGCTGGTTAGAAGCTTTCTAGACCAT
BS21989.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:14:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-a-RC | 258 | CG1268-PC | 1..258 | 17..274 | 1290 | 100 | Plus |
VhaM9.7-a-RB | 258 | CG1268-PB | 1..258 | 17..274 | 1290 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:14:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-a-RC | 710 | CG1268-RC | 60..317 | 17..274 | 1290 | 100 | Plus |
VhaM9.7-a-RB | 471 | CG1268-RB | 52..309 | 17..274 | 1290 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:13:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 4262814..4263071 | 17..274 | 1290 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 15:13:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
GATE | 8507 | GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). | 8165..8210 | 133..178 | 113 | 71.7 | Plus |
BS21989.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:14 Download gff for
BS21989.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-a-RC | 63..320 | 17..274 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:03 Download gff for
BS21989.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-a-RB | 52..309 | 17..274 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:11 Download gff for
BS21989.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-a-RB | 52..309 | 17..274 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:11 Download gff for
BS21989.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 4262814..4263071 | 17..274 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:03 Download gff for
BS21989.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 4262814..4263071 | 17..274 | 100 | | Plus |
BS21989.pep Sequence
Translation from 16 to 273
> BS21989.pep
MGAAFFPVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFW
LCCYMAQMNPLIGPKLKRDVVAMIGRSWNNPIVAG*
BS21989.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:08:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-a-PC | 85 | CG1268-PC | 1..85 | 1..85 | 475 | 100 | Plus |
VhaM9.7-a-PB | 85 | CG1268-PB | 1..85 | 1..85 | 475 | 100 | Plus |
VhaM9.7-c-PA | 84 | CG11589-PA | 4..84 | 5..85 | 264 | 53.1 | Plus |
VhaM9.7-b-PB | 89 | CG7625-PB | 9..81 | 9..82 | 226 | 50 | Plus |
VhaM9.7-b-PA | 89 | CG7625-PA | 9..81 | 9..82 | 226 | 50 | Plus |