Clone BS21993 Report

Search the DGRC for BS21993

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:219
Well:93
Vector:pDNR-Dual
Associated Gene/TranscriptCG12825-RA
Protein status:BS21993.pep: full length peptide match
Sequenced Size:467

Clone Sequence Records

BS21993.complete Sequence

467 bp assembled on 2011-01-25

GenBank Submission: KX803138

> BS21993.complete
GAAGTTATCAGTCGACATGTGGAAGCTGGACACCAAAGGAGGAATCATCT
GCTCGGGCTGCCTGTCCATAGCCTTTGCCATAACCTATCTGGTTTTGATG
GACGATTACTTCTGGAAATATGGACTCTACGAGATGGGAATACACATTTC
GGCGCTGCAGATCTTGGGAAGCGTGGTCCTCATCGTTGGAGCCATAAAGC
AAAAGCACAAGTTCTTCGTGCCGTGGATGATAACCACAGGATTCTTTTTA
TACCTGATGGTGAACCTGTTCATTTCACTGATAGTCCAGGGCACAGCTTG
GATCTTCGGACCATTGATGGTCGTTCCGTTCACAGCCTATCTGGGCTGCG
CCCTGTACTCGGTGCAGAAGGCCTTCGACAGGATGCGCAAGGAGGAGCCA
CCGGCATATGCCAGCTTGTCCGACAAGAAGGAGTTCATCAATCACATATA
GAAGCTTTCTAGACCAT

BS21993.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG12825-RA 435 CG12825-PA 1..435 17..451 2175 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG12825-RA 585 CG12825-RA 49..486 15..452 2190 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:48:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7789570..7789712 193..335 700 99.3 Plus
2R 25286936 2R 7789770..7789889 333..452 600 100 Plus
2R 25286936 2R 7789254..7789358 15..119 525 100 Plus
2R 25286936 2R 7789421..7789500 120..199 400 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:48:02 has no hits.

BS21993.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:41 Download gff for BS21993.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 43..477 17..451 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:56 Download gff for BS21993.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 51..485 17..451 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:20:34 Download gff for BS21993.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 51..485 17..451 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:34 Download gff for BS21993.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7789256..7789358 17..119 100 -> Plus
2R 7789421..7789500 120..199 100 -> Plus
2R 7789577..7789712 200..335 100 -> Plus
2R 7789773..7789888 336..451 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:56 Download gff for BS21993.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3676926..3677005 120..199 100 -> Plus
arm_2R 3677082..3677217 200..335 100 -> Plus
arm_2R 3677278..3677393 336..451 100   Plus
arm_2R 3676761..3676863 17..119 100 -> Plus

BS21993.pep Sequence

Translation from 16 to 450

> BS21993.pep
MWKLDTKGGIICSGCLSIAFAITYLVLMDDYFWKYGLYEMGIHISALQIL
GSVVLIVGAIKQKHKFFVPWMITTGFFLYLMVNLFISLIVQGTAWIFGPL
MVVPFTAYLGCALYSVQKAFDRMRKEEPPAYASLSDKKEFINHI*

BS21993.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG12825-PA 144 CG12825-PA 1..144 1..144 761 100 Plus
CG12824-PB 142 CG12824-PB 1..142 1..144 327 49 Plus
CG12824-PA 87 CG12824-PA 1..62 1..64 151 50 Plus