BS22026.complete Sequence
281 bp assembled on 2011-01-25
GenBank Submission: KX802788
> BS22026.complete
GAAGTTATCAGTCGACATGGGAGCCTGTCTGTCCTGCTGCGGCCAAAGCG
CCGAGGAAACCAACCTGATGCCATCGCCTGAGGAGCGCCGCCAGCAGCAG
TTGGATGCGGCGGAAAAGCGTCGCCAGGAGAATGAACATCGGGGCATTAA
GAATCCGGACAGCGTACGCCGACAGCAACAAAGAGCGGAGGAAATGCAAC
GCAGGGAGGAGGAGGCCGCCCGTCAGGGTCAAGGACAATCCAATCTTAGG
TGGCAAACTAGCTAAAAGCTTTCTAGACCAT
BS22026.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:16:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32039-RB | 249 | CG32039-PB | 1..249 | 17..265 | 1245 | 100 | Plus |
CG32039-RA | 249 | CG32039-PA | 1..249 | 17..265 | 1245 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:16:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32039-RB | 881 | CG32039-RB | 126..378 | 16..268 | 1265 | 100 | Plus |
CG32039-RA | 632 | CG32039-RA | 126..378 | 16..268 | 1265 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:16:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 9359246..9359416 | 80..250 | 855 | 100 | Plus |
3L | 28110227 | 3L | 9359124..9359188 | 16..80 | 325 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:16:13 has no hits.
BS22026.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:17 Download gff for
BS22026.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32039-RA | 144..390 | 17..263 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:31 Download gff for
BS22026.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32039-RA | 127..373 | 17..263 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:57 Download gff for
BS22026.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32039-RA | 127..373 | 17..263 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:57 Download gff for
BS22026.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 9359125..9359187 | 17..79 | 100 | -> | Plus |
3L | 9359246..9359416 | 80..250 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:31 Download gff for
BS22026.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 9352225..9352287 | 17..79 | 100 | -> | Plus |
arm_3L | 9352346..9352516 | 80..250 | 100 | -> | Plus |
BS22026.pep Sequence
Translation from 16 to 264
> BS22026.pep
MGACLSCCGQSAEETNLMPSPEERRQQQLDAAEKRRQENEHRGIKNPDSV
RRQQQRAEEMQRREEEAARQGQGQSNLRWQTS*
BS22026.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:10:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32039-PB | 82 | CG32039-PB | 1..82 | 1..82 | 429 | 100 | Plus |
CG32039-PA | 82 | CG32039-PA | 1..82 | 1..82 | 429 | 100 | Plus |