Clone BS22026 Report

Search the DGRC for BS22026

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:220
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptCG32039-RA
Protein status:BS22026.pep: gold
Sequenced Size:281

Clone Sequence Records

BS22026.complete Sequence

281 bp assembled on 2011-01-25

GenBank Submission: KX802788

> BS22026.complete
GAAGTTATCAGTCGACATGGGAGCCTGTCTGTCCTGCTGCGGCCAAAGCG
CCGAGGAAACCAACCTGATGCCATCGCCTGAGGAGCGCCGCCAGCAGCAG
TTGGATGCGGCGGAAAAGCGTCGCCAGGAGAATGAACATCGGGGCATTAA
GAATCCGGACAGCGTACGCCGACAGCAACAAAGAGCGGAGGAAATGCAAC
GCAGGGAGGAGGAGGCCGCCCGTCAGGGTCAAGGACAATCCAATCTTAGG
TGGCAAACTAGCTAAAAGCTTTCTAGACCAT

BS22026.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG32039-RB 249 CG32039-PB 1..249 17..265 1245 100 Plus
CG32039-RA 249 CG32039-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG32039-RB 881 CG32039-RB 126..378 16..268 1265 100 Plus
CG32039-RA 632 CG32039-RA 126..378 16..268 1265 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9359246..9359416 80..250 855 100 Plus
3L 28110227 3L 9359124..9359188 16..80 325 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:16:13 has no hits.

BS22026.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:17 Download gff for BS22026.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 144..390 17..263 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:31 Download gff for BS22026.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 127..373 17..263 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:57 Download gff for BS22026.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 127..373 17..263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:57 Download gff for BS22026.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9359125..9359187 17..79 100 -> Plus
3L 9359246..9359416 80..250 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:31 Download gff for BS22026.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9352225..9352287 17..79 100 -> Plus
arm_3L 9352346..9352516 80..250 100 -> Plus

BS22026.pep Sequence

Translation from 16 to 264

> BS22026.pep
MGACLSCCGQSAEETNLMPSPEERRQQQLDAAEKRRQENEHRGIKNPDSV
RRQQQRAEEMQRREEEAARQGQGQSNLRWQTS*

BS22026.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG32039-PB 82 CG32039-PB 1..82 1..82 429 100 Plus
CG32039-PA 82 CG32039-PA 1..82 1..82 429 100 Plus