Clone BS22056 Report

Search the DGRC for BS22056

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:220
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG34310-RA
Protein status:BS22056.pep: full length peptide match
Sequenced Size:276

Clone Sequence Records

BS22056.complete Sequence

276 bp assembled on 2011-01-25

GenBank Submission: KX803107

> BS22056.complete
GAAGTTATCAGTCGACATGAGTTTCATTAACGGCTTCAAAAGATTCGCCA
CAACGACGGTTGGTCTGATGGCCATCGGTATTGGATCGACTGTTATATTC
TACACCACCCATCGCCTTGTCATCAAACCCTATCTTCTCGAGAAACGACG
CCTGGAAGCCGAGGCCAGTGCGGAGTACCTCTTCCAGCAGGAGGTTCACT
CCCAGATTGGCGAGTCAAGACCCAAACGGAGCGAATATTGAAAGCTTTCT
AGACCATTCGTGGGGCGCGCAAACGG

BS22056.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG34310-RD 225 CG34310-PD 1..225 17..241 1125 100 Plus
CG34310-RA 225 CG34310-PA 1..225 17..241 1125 100 Plus
CG34310-RC 225 CG34310-PC 1..225 17..241 1125 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG34310-RD 4306 CG34310-RD 3827..4051 17..241 1125 100 Plus
CG34310-RA 706 CG34310-RA 266..490 17..241 1125 100 Plus
CG34310-RC 4002 CG34310-RC 3523..3747 17..241 1125 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6674301..6674525 17..241 1125 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:20:45 has no hits.

BS22056.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:20 Download gff for BS22056.complete
Subject Subject Range Query Range Percent Splice Strand
cup-RB 3526..3752 17..245 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:51:41 Download gff for BS22056.complete
Subject Subject Range Query Range Percent Splice Strand
cup-RB 3523..3749 17..245 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:24 Download gff for BS22056.complete
Subject Subject Range Query Range Percent Splice Strand
CG34310-RC 3523..3749 17..245 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:24 Download gff for BS22056.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6674301..6674527 17..245 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:51:41 Download gff for BS22056.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6674301..6674527 17..245 99   Plus

BS22056.pep Sequence

Translation from 16 to 240

> BS22056.pep
MSFINGFKRFATTTVGLMAIGIGSTVIFYTTHRLVIKPYLLEKRRLEAEA
SAEYLFQQEVHSQIGESRPKRSEY*

BS22056.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG34310-PD 74 CG34310-PD 1..74 1..74 372 100 Plus
CG34310-PA 74 CG34310-PA 1..74 1..74 372 100 Plus
CG34310-PC 74 CG34310-PC 1..74 1..74 372 100 Plus