BS22056.complete Sequence
276 bp assembled on 2011-01-25
GenBank Submission: KX803107
> BS22056.complete
GAAGTTATCAGTCGACATGAGTTTCATTAACGGCTTCAAAAGATTCGCCA
CAACGACGGTTGGTCTGATGGCCATCGGTATTGGATCGACTGTTATATTC
TACACCACCCATCGCCTTGTCATCAAACCCTATCTTCTCGAGAAACGACG
CCTGGAAGCCGAGGCCAGTGCGGAGTACCTCTTCCAGCAGGAGGTTCACT
CCCAGATTGGCGAGTCAAGACCCAAACGGAGCGAATATTGAAAGCTTTCT
AGACCATTCGTGGGGCGCGCAAACGG
BS22056.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:20:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34310-RD | 225 | CG34310-PD | 1..225 | 17..241 | 1125 | 100 | Plus |
CG34310-RA | 225 | CG34310-PA | 1..225 | 17..241 | 1125 | 100 | Plus |
CG34310-RC | 225 | CG34310-PC | 1..225 | 17..241 | 1125 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:20:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34310-RD | 4306 | CG34310-RD | 3827..4051 | 17..241 | 1125 | 100 | Plus |
CG34310-RA | 706 | CG34310-RA | 266..490 | 17..241 | 1125 | 100 | Plus |
CG34310-RC | 4002 | CG34310-RC | 3523..3747 | 17..241 | 1125 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:20:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 6674301..6674525 | 17..241 | 1125 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:20:45 has no hits.
BS22056.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:20 Download gff for
BS22056.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cup-RB | 3526..3752 | 17..245 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:51:41 Download gff for
BS22056.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cup-RB | 3523..3749 | 17..245 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:24 Download gff for
BS22056.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34310-RC | 3523..3749 | 17..245 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:24 Download gff for
BS22056.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6674301..6674527 | 17..245 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:51:41 Download gff for
BS22056.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 6674301..6674527 | 17..245 | 99 | | Plus |
BS22056.pep Sequence
Translation from 16 to 240
> BS22056.pep
MSFINGFKRFATTTVGLMAIGIGSTVIFYTTHRLVIKPYLLEKRRLEAEA
SAEYLFQQEVHSQIGESRPKRSEY*
BS22056.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:10:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34310-PD | 74 | CG34310-PD | 1..74 | 1..74 | 372 | 100 | Plus |
CG34310-PA | 74 | CG34310-PA | 1..74 | 1..74 | 372 | 100 | Plus |
CG34310-PC | 74 | CG34310-PC | 1..74 | 1..74 | 372 | 100 | Plus |