BS22060.complete Sequence
263 bp assembled on 2011-01-25
GenBank Submission: KX802605
> BS22060.complete
GAAGTTATCAGTCGACATGGCCAAGTCCAAGAACCACACAAATCACAACC
AGAACAAGAAGGCCCATCGTAATGGCATCAAGCGCCCGCTGCGCAAACGC
CACGAGTCCACTCTGGGTATGGATGTGAAATTCCTGATCAACCAGCGCTA
CGCACGCAAGGGAAACCTTTCCCGCGAGGAGTCCGTGAAGCGCTACAACG
AGCGCATCGCTTCCCAGAAGGGCAAGCCAAAGCCTGTTACTCTGTAGAAG
CTTTCTAGACCAT
BS22060.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:17:29
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL29-RD | 231 | CG10071-PD | 1..231 | 17..247 | 1140 | 99.6 | Plus |
| RpL29-RB | 231 | CG10071-PB | 1..231 | 17..247 | 1140 | 99.6 | Plus |
| RpL29-RA | 231 | CG10071-PA | 1..231 | 17..247 | 1140 | 99.6 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:17:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL29-RD | 304 | CG10071-RD | 29..260 | 17..248 | 1145 | 99.6 | Plus |
| RpL29-RB | 389 | CG10071-RB | 114..345 | 17..248 | 1145 | 99.6 | Plus |
| RpL29-RA | 329 | CG10071-RA | 54..285 | 17..248 | 1145 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:17:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 21294231..21294360 | 119..248 | 635 | 99.2 | Plus |
| 2R | 25286936 | 2R | 21294060..21294161 | 17..118 | 510 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:17:28 has no hits.
BS22060.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:19 Download gff for
BS22060.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL29-RB | 99..329 | 17..247 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:58 Download gff for
BS22060.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL29-RA | 54..284 | 17..247 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:10:22 Download gff for
BS22060.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL29-RA | 54..284 | 17..247 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:10:22 Download gff for
BS22060.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 21294060..21294161 | 17..118 | 100 | -> | Plus |
| 2R | 21294231..21294359 | 119..247 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:58 Download gff for
BS22060.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 17181565..17181666 | 17..118 | 100 | -> | Plus |
| arm_2R | 17181736..17181864 | 119..247 | 99 | | Plus |
BS22060.pep Sequence
Translation from 16 to 246
> BS22060.pep
MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGN
LSREESVKRYNERIASQKGKPKPVTL*
BS22060.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:10:38
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL29-PD | 76 | CG10071-PD | 1..76 | 1..76 | 396 | 100 | Plus |
| RpL29-PB | 76 | CG10071-PB | 1..76 | 1..76 | 396 | 100 | Plus |
| RpL29-PA | 76 | CG10071-PA | 1..76 | 1..76 | 396 | 100 | Plus |
