BS22063.complete Sequence
200 bp assembled on 2011-01-25
GenBank Submission: KX805337
> BS22063.complete
GAAGTTATCAGTCGACATGAAGGTTATCTACAACACCCTGTTCAAGCGCA
CCTCCACCTACGCCGTGGCCATCATCGCGTCGGCCTTTTTCTTCGAGCGC
GCTCTCGATGTCACGTCGGTTGCGATTTTCGAGGGCATCAACAAAGGCAA
ACTCTGGAAGGACATCAAGGGAAAATACGAATAAAAGCTTTCTAGACCAT
BS22063.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:48:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ox-RA | 168 | CG8764-PA | 1..168 | 17..184 | 825 | 99.4 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:48:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ox-RA | 331 | CG8764-RA | 99..269 | 15..185 | 840 | 99.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:48:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 12757298..12757431 | 148..15 | 670 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:48:36 has no hits.
BS22063.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:42 Download gff for
BS22063.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ox-RA | 95..260 | 17..182 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:58:02 Download gff for
BS22063.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ox-RA | 101..266 | 17..182 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:20:44 Download gff for
BS22063.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ox-RA | 101..266 | 17..182 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:44 Download gff for
BS22063.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12757198..12757231 | 149..182 | 97 | <- | Minus |
2R | 12757298..12757429 | 17..148 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:58:02 Download gff for
BS22063.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 8644703..8644736 | 149..182 | 97 | <- | Minus |
arm_2R | 8644803..8644934 | 17..148 | 100 | | Minus |
BS22063.pep Sequence
Translation from 16 to 183
> BS22063.pep
MKVIYNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKGKLWKDI
KGKYE*
BS22063.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ox-PA | 55 | CG8764-PA | 1..55 | 1..55 | 277 | 100 | Plus |