Clone BS22063 Report

Search the DGRC for BS22063

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:220
Well:63
Vector:pDNR-Dual
Associated Gene/Transcriptox-RA
Protein status:BS22063.pep: gold
Sequenced Size:200

Clone Sequence Records

BS22063.complete Sequence

200 bp assembled on 2011-01-25

GenBank Submission: KX805337

> BS22063.complete
GAAGTTATCAGTCGACATGAAGGTTATCTACAACACCCTGTTCAAGCGCA
CCTCCACCTACGCCGTGGCCATCATCGCGTCGGCCTTTTTCTTCGAGCGC
GCTCTCGATGTCACGTCGGTTGCGATTTTCGAGGGCATCAACAAAGGCAA
ACTCTGGAAGGACATCAAGGGAAAATACGAATAAAAGCTTTCTAGACCAT

BS22063.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
ox-RA 168 CG8764-PA 1..168 17..184 825 99.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
ox-RA 331 CG8764-RA 99..269 15..185 840 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12757298..12757431 148..15 670 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:48:36 has no hits.

BS22063.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:42 Download gff for BS22063.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 95..260 17..182 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:58:02 Download gff for BS22063.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 101..266 17..182 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:20:44 Download gff for BS22063.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 101..266 17..182 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:44 Download gff for BS22063.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12757198..12757231 149..182 97 <- Minus
2R 12757298..12757429 17..148 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:58:02 Download gff for BS22063.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8644703..8644736 149..182 97 <- Minus
arm_2R 8644803..8644934 17..148 100   Minus

BS22063.pep Sequence

Translation from 16 to 183

> BS22063.pep
MKVIYNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKGKLWKDI
KGKYE*

BS22063.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
ox-PA 55 CG8764-PA 1..55 1..55 277 100 Plus