Clone BS22066 Report

Search the DGRC for BS22066

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:220
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG9603-RA
Protein status:BS22066.pep: full length peptide match
Sequenced Size:302

Clone Sequence Records

BS22066.complete Sequence

302 bp assembled on 2011-01-25

GenBank Submission: KX805564

> BS22066.complete
GAAGTTATCAGTCGACATGATGAACCTGTCGAGAGCTGTTGTCCGTAGCT
TCGCTACCACCGCTGGCCGCCGGTCCGCCGCCGTGCCCAAGGACCAGATC
GAGAAGGGATACTTCGAGATCCGCAAGGTGCAGGAGCACTTTCAGAAGAA
GGACGGCAAGCCCGTCTTCCTCAAGGGATCCGTCGTGGACAACGTGCTCT
ACCGCGTCACCGTCGCTCTCGCCCTCGTCGGCATCGGTGGCATGGGCAAG
CTTTTCTACGAGCTGAGTGTTCCCAAGAAGGAGTGAAAGCTTTCTAGACC
AT

BS22066.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:21:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG9603-RA 270 CG9603-PA 1..270 17..286 1350 100 Plus
CG9603-RB 297 CG9603-PB 46..297 35..286 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG9603-RA 621 CG9603-RA 114..384 17..287 1355 100 Plus
CG9603-RB 566 CG9603-RB 77..329 35..287 1265 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8340519..8340771 287..35 1265 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:21:45 has no hits.

BS22066.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:22 Download gff for BS22066.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 112..380 17..285 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:51:54 Download gff for BS22066.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 114..382 17..285 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:43 Download gff for BS22066.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 114..382 17..285 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:43 Download gff for BS22066.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8340521..8340771 35..285 100 <- Minus
3R 8340913..8340930 17..34 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:51:54 Download gff for BS22066.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4166243..4166493 35..285 100 <- Minus
arm_3R 4166635..4166652 17..34 100   Minus

BS22066.pep Sequence

Translation from 16 to 285

> BS22066.pep
MMNLSRAVVRSFATTAGRRSAAVPKDQIEKGYFEIRKVQEHFQKKDGKPV
FLKGSVVDNVLYRVTVALALVGIGGMGKLFYELSVPKKE*

BS22066.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:10:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG9603-PA 89 CG9603-PA 1..89 1..89 444 100 Plus
CG9603-PB 98 CG9603-PB 16..98 7..89 415 100 Plus