Clone BS22073 Report

Search the DGRC for BS22073

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:220
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptAkh-RA
Protein status:BS22073.pep: gold
Sequenced Size:272

Clone Sequence Records

BS22073.complete Sequence

272 bp assembled on 2011-01-25

GenBank Submission: KX802662

> BS22073.complete
GAAGTTATCAGTCGACATGAATCCCAAGAGCGAAGTCCTCATTGCAGCCG
TGCTCTTCATGCTGCTGGCCTGCGTCCAGTGTCAATTGACCTTCTCGCCG
GATTGGGGCAAGCGTTCGGTGGGCGGAGCTGGTCCTGGAACCTTTTTCGA
GACACAGCAGGGCAACTGCAAGACCTCCAACGAAATGCTGCTCGAGATCT
TCCGCTTCGTGCAATCTCAGGCACAGCTCTTTCTGGACTGCAAGCACCGC
GAGTAGAAGCTTTCTAGACCAT

BS22073.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Akh-RA 240 CG1171-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
Akh-RA 536 CG1171-RA 120..360 17..257 1205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4141723..4141894 86..257 860 100 Plus
3L 28110227 3L 4141586..4141658 17..89 350 98.6 Plus
Blast to na_te.dros performed on 2014-11-26 15:48:46 has no hits.

BS22073.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:43 Download gff for BS22073.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 120..359 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:58:04 Download gff for BS22073.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 120..359 17..256 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:20:49 Download gff for BS22073.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 120..359 17..256 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:49 Download gff for BS22073.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4141586..4141654 17..85 100 -> Plus
3L 4141723..4141893 86..256 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:58:04 Download gff for BS22073.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4141586..4141654 17..85 100 -> Plus
arm_3L 4141723..4141893 86..256 100   Plus

BS22073.pep Sequence

Translation from 16 to 255

> BS22073.pep
MNPKSEVLIAAVLFMLLACVQCQLTFSPDWGKRSVGGAGPGTFFETQQGN
CKTSNEMLLEIFRFVQSQAQLFLDCKHRE*

BS22073.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Akh-PA 79 CG1171-PA 1..79 1..79 418 100 Plus