Clone BS22085 Report

Search the DGRC for BS22085

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:220
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCG13056-RA
Protein status:BS22085.pep: full length peptide match
Sequenced Size:332

Clone Sequence Records

BS22085.complete Sequence

332 bp assembled on 2011-01-25

GenBank Submission: KX804530

> BS22085.complete
GAAGTTATCAGTCGACATGTCACAGAGAATGTACTTATCCTTTGCTCTCT
TACTTTGCCTTTTGGCACTTGGAAATGCCGATCTGCAATTGTATCATCCC
CTGATGACCCTGCACCACCCACCAACTTTTGCCAAGGTGGGCCATCTGGT
GGAGCATGTGCCCACCGCAGTTTCGCACCAGAGTTCCACCATCGTTCATC
GCAGTGTTCCGAGGACTACATCACTGTTGACACCCGCTTTGAGGTCCACC
TATCTGAACTATCCCACCTGGGGTTATCCACTTTTCGATGGCACCAACAC
GCTGTACAGAAAGTAGAAGCTTTCTAGACCAT

BS22085.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13056-RA 300 CG13056-PA 1..300 17..316 1500 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13056-RA 402 CG13056-RA 23..322 17..316 1500 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16333417..16333702 31..316 1430 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:44:59 has no hits.

BS22085.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:36 Download gff for BS22085.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 23..322 17..316 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:15 Download gff for BS22085.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 23..322 17..316 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:19:27 Download gff for BS22085.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 23..322 17..316 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:19:27 Download gff for BS22085.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16333418..16333702 32..316 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:15 Download gff for BS22085.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16326518..16326802 32..316 100   Plus

BS22085.pep Sequence

Translation from 16 to 315

> BS22085.pep
MSQRMYLSFALLLCLLALGNADLQLYHPLMTLHHPPTFAKVGHLVEHVPT
AVSHQSSTIVHRSVPRTTSLLTPALRSTYLNYPTWGYPLFDGTNTLYRK*

BS22085.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13056-PA 99 CG13056-PA 1..99 1..99 527 100 Plus