Clone BS22134 Report

Search the DGRC for BS22134

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:221
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptYippee-RB
Protein status:BS22134.pep: full length peptide match
Sequenced Size:365

Clone Sequence Records

BS22134.complete Sequence

365 bp assembled on 2011-01-27

GenBank Submission: KX804286

> BS22134.complete
GAAGTTATCAGTCGACATGGGACGCATTTTCTTGGAACATCTTGGGGGTC
TGAAACTCTTCAATTGCGCCCAATGCCACACGAACCTGACCAACCGCAGT
CAATTGATCAGTACCCGATTCACAGGCGCAACAGGACGCGCCTATCTGTT
TAAGCGTGTGGTCAACCTGACCTTCAGCAACATCCAGGAACGGGTCATGC
TCACGGGTCGCCACATGGTGCGCGACGTTATGTGCAAGAATTGTGGAGCC
AAACTTGGCTGGATGTACGAGTTCGCCACCGAAGAGTCACAAAAGTGGGT
AAACGCGGATAGGCAGCTTGTCACTAGGGATTCTGGGTTATACAAGTAGA
AGCTTTCTAGACCAT

BS22134.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
Yippee-RB 333 CG1989-PB 1..333 17..349 1665 100 Plus
Yippee-RA 366 CG1989-PA 1..278 17..294 1390 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
Yippee-RB 1293 CG1989-RB 341..673 17..349 1665 100 Plus
Yippee-RA 1136 CG1989-RA 341..618 17..294 1390 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13386534..13386752 349..131 1095 100 Minus
X 23542271 X 13386814..13386932 135..17 595 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:56:48 has no hits.

BS22134.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:05:18 Download gff for BS22134.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RB 318..650 17..349 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:48:19 Download gff for BS22134.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RB 318..650 17..349 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:07:29 Download gff for BS22134.complete
Subject Subject Range Query Range Percent Splice Strand
Yippee-RB 341..673 17..349 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:07:29 Download gff for BS22134.complete
Subject Subject Range Query Range Percent Splice Strand
X 13386534..13386748 135..349 100 <- Minus
X 13386815..13386932 17..134 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:48:19 Download gff for BS22134.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13280567..13280781 135..349 100 <- Minus
arm_X 13280848..13280965 17..134 100   Minus

BS22134.pep Sequence

Translation from 16 to 348

> BS22134.pep
MGRIFLEHLGGLKLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVN
LTFSNIQERVMLTGRHMVRDVMCKNCGAKLGWMYEFATEESQKWVNADRQ
LVTRDSGLYK*

BS22134.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Yippee-PB 110 CG1989-PB 1..110 1..110 585 100 Plus
Yippee-PA 121 CG1989-PA 1..94 1..94 496 98.9 Plus
CG15309-PE 114 CG15309-PE 14..95 13..94 204 45.1 Plus
CG15309-PD 114 CG15309-PD 14..95 13..94 204 45.1 Plus
CG15309-PC 114 CG15309-PC 14..95 13..94 204 45.1 Plus