Clone BS22304 Report

Search the DGRC for BS22304

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:223
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptCG14300-RA
Protein status:BS22304.pep: full length peptide match
Sequenced Size:317

Clone Sequence Records

BS22304.complete Sequence

317 bp assembled on 2011-01-27

GenBank Submission: KX806465

> BS22304.complete
GAAGTTATCAGTCGACATGAAGTCTGTTGTTGCCCTGTTTGCCACCGTTT
TGGCCATTATTTTGGTGGCTGGAGTGAGTGCGGATGCGGGTCGCTCCGCC
TGCAAGGATGAGTCCGAGATTGGACAGACCTATACGCATCACTTCGATGC
CGCTAAGTACTGGCTGTGCGAGACCCTTGGCGTTCCGGCCACCGAGGTGG
ACTGCCCCGCGGGACTGGCCTACATGCATCTGCTCAAGGAGTGCATCCCA
TGGGCCAGTTACATCTGGAAGAAGCCCGAGATGCCACCAACTGTGGCCTG
AAAGCTTTCTAGACCAT

BS22304.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14300-RA 285 CG14300-PA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG14300-RA 357 CG14300-RA 46..332 17..303 1435 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18693318..18693595 303..26 1390 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:35:59 has no hits.

BS22304.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:50 Download gff for BS22304.complete
Subject Subject Range Query Range Percent Splice Strand
CG14300-RA 30..313 17..300 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:14 Download gff for BS22304.complete
Subject Subject Range Query Range Percent Splice Strand
CG14300-RA 41..324 17..300 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:31 Download gff for BS22304.complete
Subject Subject Range Query Range Percent Splice Strand
CG14300-RA 46..329 17..300 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:31 Download gff for BS22304.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18693321..18693597 20..300 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:14 Download gff for BS22304.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14519043..14519319 20..300 98   Minus

BS22304.pep Sequence

Translation from 16 to 300

> BS22304.pep
MKSVVALFATVLAIILVAGVSADAGRSACKDESEIGQTYTHHFDAAKYWL
CETLGVPATEVDCPAGLAYMHLLKECIPWASYIWKKPEMPPTVA*

BS22304.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG14300-PA 94 CG14300-PA 1..94 1..94 504 100 Plus
CG14645-PA 97 CG14645-PA 1..91 1..90 161 34.1 Plus
CG14245-PB 103 CG14245-PB 22..97 18..92 156 34.2 Plus
CG14245-PA 103 CG14245-PA 22..97 18..92 156 34.2 Plus