Clone BS22313 Report

Search the DGRC for BS22313

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:223
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG34193-RA
Protein status:BS22313.pep: gold
Sequenced Size:266

Clone Sequence Records

BS22313.complete Sequence

266 bp assembled on 2011-01-27

GenBank Submission: KX804452

> BS22313.complete
GAAGTTATCAGTCGACATGAAAGTACTCCTGGCTTTAACTTTCCTGGCCA
CTTTGGCTCTTTCAGTGGCCCTTCCCCAGGTGGGACATGGATCTGTAAAT
GGACCCAGTGGGCGCTTCCCTATGACGAAGAATTGGGCGCAACCTCCGGT
TGATTTGCGAAAACCCATTATCTTTCTGCCAGAGGCCACGCCCATTCACG
AAGCCCAGGAGTCGCGCCCCCGACTAGCCAAACATCGCAAGAGTGGATAG
AAGCTTTCTAGACCAT

BS22313.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG34193-RB 234 CG34193-PB 1..234 17..250 1170 100 Plus
CG34193-RA 234 CG34193-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34193-RB 2333 CG34193-RB 989..1223 17..251 1175 100 Plus
CG34193-RA 806 CG34193-RA 58..292 17..251 1175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17510145..17510284 112..251 700 100 Plus
2R 25286936 2R 17509983..17510078 17..112 480 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:37:07 has no hits.

BS22313.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:06:52 Download gff for BS22313.complete
Subject Subject Range Query Range Percent Splice Strand
CG34193-RA 34..267 17..250 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:39 Download gff for BS22313.complete
Subject Subject Range Query Range Percent Splice Strand
CG34193-RA 40..273 17..250 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:55 Download gff for BS22313.complete
Subject Subject Range Query Range Percent Splice Strand
CG34193-RA 58..291 17..250 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:55 Download gff for BS22313.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17509983..17510078 17..112 100 -> Plus
2R 17510146..17510283 113..250 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:39 Download gff for BS22313.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13397488..13397583 17..112 100 -> Plus
arm_2R 13397651..13397788 113..250 100   Plus

BS22313.pep Sequence

Translation from 16 to 249

> BS22313.pep
MKVLLALTFLATLALSVALPQVGHGSVNGPSGRFPMTKNWAQPPVDLRKP
IIFLPEATPIHEAQESRPRLAKHRKSG*

BS22313.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG34193-PB 77 CG34193-PB 1..77 1..77 398 100 Plus
CG34193-PA 77 CG34193-PA 1..77 1..77 398 100 Plus