BS22429.complete Sequence
392 bp assembled on 2012-04-25
GenBank Submission: KX805623
> BS22429.complete
GAAGTTATCAGTCGACATGTGTTCCCGCAACATAAAGATCTCGGTGGTGC
TGTTTCTCGTCCTGATACCAATCTTCGCCGCCTTGCCACACAACCACAAT
CTGTCGAAGCGCAGCAACTTCTTCGACCTGGAGTGCAAGGGCATCTTCAA
CAAGACCATGTTCTTCCGACTGGACCGCATCTGCGAGGACTGCTACCAGT
TGTTCCGCGAGACGAGTATACACCGATTATGCAAGAAAGACTGCTTTGAT
TCAAAATGGTTTGGCGAATGCCTGAAAGTGCTGTTAATACCCGAAGAGGA
AATATCCAACCTACAGCACTTTCTGAGAGTAGTGAACGGCTCGCCCATAT
CCTTCAACATGGGGCCGCAAACATAAAAGCTTTCTAGACCAT
BS22429.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:58:32
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| ITP-RG | 360 | CG13586-PG | 1..360 | 17..376 | 1785 | 99.7 | Plus |
| ITP-RD | 360 | CG13586-PD | 1..360 | 17..376 | 1785 | 99.7 | Plus |
| ITP-RF | 360 | CG13586-PF | 1..360 | 17..376 | 1785 | 99.7 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:58:33
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| ITP-RG | 974 | CG13586-RG | 103..462 | 17..376 | 1785 | 99.7 | Plus |
| ITP-RD | 3646 | CG13586-RD | 1081..1440 | 17..376 | 1785 | 99.7 | Plus |
| ITP-RF | 1531 | CG13586-RF | 660..1019 | 17..376 | 1785 | 99.7 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:58:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 24555354..24555576 | 17..239 | 1085 | 99.1 | Plus |
| 2R | 25286936 | 2R | 24556284..24556425 | 235..376 | 710 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 11:58:31 has no hits.
BS22429.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-25 15:16:58 Download gff for
BS22429.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| itp-RD | 1080..1431 | 17..368 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:36:18 Download gff for
BS22429.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| itp-RF | 660..1011 | 17..368 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:54:42 Download gff for
BS22429.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| ITP-RF | 660..1011 | 17..368 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:54:42 Download gff for
BS22429.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 24555354..24555571 | 17..234 | 99 | -> | Plus |
| 2R | 24556284..24556417 | 235..368 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:36:18 Download gff for
BS22429.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 20442877..20443094 | 17..234 | 99 | -> | Plus |
| arm_2R | 20443807..20443940 | 235..368 | 100 | | Plus |
BS22429.pep Sequence
Translation from 16 to 375
> BS22429.pep
MCSRNIKISVVLFLVLIPIFAALPHNHNLSKRSNFFDLECKGIFNKTMFF
RLDRICEDCYQLFRETSIHRLCKKDCFDSKWFGECLKVLLIPEEEISNLQ
HFLRVVNGSPISFNMGPQT*
BS22429.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:23:53
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| ITP-PG | 119 | CG13586-PG | 1..119 | 1..119 | 641 | 100 | Plus |
| ITP-PD | 119 | CG13586-PD | 1..119 | 1..119 | 641 | 100 | Plus |
| ITP-PF | 119 | CG13586-PF | 1..119 | 1..119 | 641 | 100 | Plus |
| ITP-PC | 119 | CG13586-PC | 1..114 | 1..114 | 529 | 86 | Plus |
| ITP-PE | 108 | CG13586-PE | 1..94 | 1..94 | 441 | 86.2 | Plus |
