Clone BS22501 Report

Search the DGRC for BS22501

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:225
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptTfIIA-S-RA
Protein status:BS22501.pep: full length peptide match
Sequenced Size:353

Clone Sequence Records

BS22501.complete Sequence

353 bp assembled on 2011-01-25

GenBank Submission: KX802994

> BS22501.complete
GAAGTTATCAGTCGACATGTCGTATCAACTGTACCGCAACACCACGCTCG
GCAACACCCTGCAGGAGAGCCTCGACGAGCTGATTCAGTACGGCCAGATT
ACGCCCGGACTGGCTTTCAAGGTTCTGCTGCAATTCGACAAGAGCATCAA
CAATGCCCTAAACCAGCGGGTCAAGGCCCGCGTCACCTTCAAGGCTGGAA
AACTAAACACCTACCGCTTCTGCGACAATGTCTGGACTCTCATGCTTAAC
GATGTGGAGTTCCGCGAAGTGCACGAGATCGTCAAGGTGGACAAGGTGAA
GATCGTGGCCTGCGACGGCAAGAGCGGCGAGTTCTGAAAGCTTTCTAGAC
CAT

BS22501.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:28:04
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-S-RA 321 CG5163-PA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-S-RA 617 CG5163-RA 106..427 17..338 1610 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23890578..23890830 338..86 1265 100 Minus
3R 32079331 3R 23890884..23890955 88..17 360 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:28:03 has no hits.

BS22501.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:26 Download gff for BS22501.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 102..421 17..336 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:53:14 Download gff for BS22501.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 106..425 17..336 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:13:39 Download gff for BS22501.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIA-S-RA 106..425 17..336 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:13:39 Download gff for BS22501.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23890580..23890827 89..336 100 <- Minus
3R 23890884..23890955 17..88 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:53:14 Download gff for BS22501.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19716302..19716549 89..336 100 <- Minus
arm_3R 19716606..19716677 17..88 100   Minus

BS22501.pep Sequence

Translation from 16 to 336

> BS22501.pep
MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQ
RVKARVTFKAGKLNTYRFCDNVWTLMLNDVEFREVHEIVKVDKVKIVACD
GKSGEF*

BS22501.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIA-S-PA 106 CG5163-PA 1..106 1..106 547 100 Plus
TfIIA-S-2-PA 107 CG11639-PA 1..101 1..101 278 55.4 Plus