BS22509.complete Sequence
170 bp assembled on 2011-01-25
GenBank Submission: KX805938
> BS22509.complete
GAAGTTATCAGTCGACATGCGATTCTTTGCAATCGTCACTGTCTTTGTGC
TTGGTCTTCTGGCTTTGGCCAATGCTATTCCGTTGTCACCCGATCCAGGA
AATGTTATCATCAATGGCGACTGTGTGAATTGCAATGTTCGTGGTGGCAA
ATAGAAGCTTTCTAGACCAT
BS22509.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:45:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18107-RA | 138 | CG18107-PA | 1..138 | 17..154 | 690 | 100 | Plus |
IM1-RA | 138 | CG18108-PA | 6..138 | 22..154 | 305 | 82 | Plus |
IM2-RA | 138 | CG18106-PA | 7..107 | 23..123 | 235 | 82.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:45:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18107-RA | 281 | CG18107-RA | 71..210 | 17..156 | 700 | 100 | Plus |
IM1-RA | 361 | CG18108-RA | 80..212 | 22..154 | 305 | 82 | Plus |
IM2-RA | 367 | CG18106-RA | 78..178 | 23..123 | 235 | 82.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:45:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 18384758..18384840 | 74..156 | 415 | 100 | Plus |
2R | 25286936 | 2R | 18384637..18384694 | 17..74 | 290 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 15:45:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy3 | 6973 | gypsy3 GYPSY3 6973bp | 6248..6272 | 91..115 | 98 | 88 | Plus |
BS22509.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:37 Download gff for
BS22509.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18107-RA | 73..204 | 17..148 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:25 Download gff for
BS22509.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18107-RA | 71..202 | 17..148 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:19:41 Download gff for
BS22509.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18107-RA | 71..202 | 17..148 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:19:41 Download gff for
BS22509.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18384637..18384694 | 17..74 | 100 | -> | Plus |
2R | 18384759..18384832 | 75..148 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:25 Download gff for
BS22509.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14272142..14272199 | 17..74 | 100 | -> | Plus |
arm_2R | 14272264..14272337 | 75..148 | 100 | | Plus |
BS22509.pep Sequence
Translation from 16 to 153
> BS22509.pep
MRFFAIVTVFVLGLLALANAIPLSPDPGNVIINGDCVNCNVRGGK*
BS22509.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18107-PA | 45 | CG18107-PA | 1..45 | 1..45 | 234 | 100 | Plus |
IM2-PA | 45 | CG18106-PA | 1..45 | 1..45 | 202 | 80 | Plus |
IM1-PA | 45 | CG18108-PA | 1..45 | 1..45 | 202 | 82.2 | Plus |
IM3-PB | 39 | CG16844-PB | 1..38 | 1..42 | 127 | 69 | Plus |
IM3-PA | 39 | CG16844-PA | 1..38 | 1..42 | 127 | 69 | Plus |