Clone BS22513 Report

Search the DGRC for BS22513

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:225
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG32027-RA
Protein status:BS22513.pep: full length peptide match
Sequenced Size:269

Clone Sequence Records

BS22513.complete Sequence

269 bp assembled on 2011-01-25

GenBank Submission: KX801651

> BS22513.complete
GAAGTTATCAGTCGACATGATGAGGAGACGGTGTACCGTGAAAACGGGAA
CTGCTGTGCCATTTAGACCAAACTGGCAACCTGTTACATATTTCAGCCAC
GTTAGCCAGGCGACACCTGAAGGTAATAACGGCAGGCCACCTGTTGCTGA
TCACAAAGACTACAGGAATTTGAAATTACTGACACAGTACCCAATACTAT
GCCCTTATTTATTCTTAGAACATATGTACATAAATACATTAATCGGCATT
TAAAAGCTTTCTAGACCAT

BS22513.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-26 14:52:07 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-26 14:52:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18842345..18842576 22..253 1160 100 Plus
Blast to na_te.dros performed 2014-11-26 14:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 3172..3271 163..262 113 57 Plus

BS22513.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:35 Download gff for BS22513.complete
Subject Subject Range Query Range Percent Splice Strand
CG32027-RA 619..852 17..251 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:01:47 Download gff for BS22513.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18842340..18842574 17..251 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:01:47 Download gff for BS22513.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18842340..18842574 17..251 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:44:26 Download gff for BS22513.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18835440..18835674 17..251 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:44:26 Download gff for BS22513.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18835440..18835674 17..251 98   Plus

BS22513.pep Sequence

Translation from 16 to 252

> BS22513.pep
MMRRRCTVKTGTAVPFRPNWQPVTYFSHVSQATPEGNNGRPPVADHKDYR
NLKLLTQYPILCPYLFLEHMYINTLIGI*
Sequence BS22513.pep has no blast hits.