Clone BS22539 Report

Search the DGRC for BS22539

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:225
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptRpL35-RA
Protein status:BS22539.pep: full length peptide match
Sequenced Size:404

Clone Sequence Records

BS22539.complete Sequence

404 bp assembled on 2011-01-25

GenBank Submission: KX802356

> BS22539.complete
GAAGTTATCAGTCGACATGGTGAAGGTTAAGTGCTCCGAGCTGAGGATCA
AGGACAAGAAGGAACTCACCAAGCAATTGGATGAGCTCAAGAATGAGTTG
CTCAGCCTGCGCGTGGCCAAGGTGACCGGCGGAGCTCCCTCCAAGCTCTC
CAAGATCCGCGTTGTCCGCAAGGCCATCGCTCGCGTCTACATTGTGATGC
ACCAGAAGCAGAAGGAGAATCTGCGCAAGGTCTTCAAGAACAAGAAGTAC
AAGCCCCTGGATCTGCGCAAGAAGAAGACCCGCGCTATCCGCAAGGCCCT
GTCTCCGCGCGACGCCAACCGCAAGACCCTCAAGGAGATCCGCAAGCGCT
CCGTCTTCCCCCAGAGGAAGTTCGCCGTCAAGGCCTAGAAGCTTTCTAGA
CCAT

BS22539.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
RpL35-RC 372 CG4111-PC 1..372 17..388 1860 100 Plus
RpL35-RA 372 CG4111-PA 1..372 17..388 1860 100 Plus
RpL35-RB 372 CG4111-PB 1..372 17..388 1860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
RpL35-RC 590 CG4111-RC 120..493 17..390 1870 100 Plus
RpL35-RA 606 CG4111-RA 140..513 17..390 1870 100 Plus
RpL35-RB 507 CG4111-RB 41..414 17..390 1870 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:55:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5673217..5673450 157..390 1170 100 Plus
X 23542271 X 5672997..5673134 19..156 690 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:55:47 has no hits.

BS22539.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:43 Download gff for BS22539.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35-RA 216..587 17..388 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:45:45 Download gff for BS22539.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35-RB 41..412 17..388 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:03:00 Download gff for BS22539.complete
Subject Subject Range Query Range Percent Splice Strand
RpL35-RB 41..412 17..388 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:03:00 Download gff for BS22539.complete
Subject Subject Range Query Range Percent Splice Strand
X 5672996..5673134 17..156 99 -> Plus
X 5673217..5673448 157..388 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:45:45 Download gff for BS22539.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5567029..5567167 17..156 99 -> Plus
arm_X 5567250..5567481 157..388 100   Plus

BS22539.pep Sequence

Translation from 16 to 387

> BS22539.pep
MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVV
RKAIARVYIVMHQKQKENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDA
NRKTLKEIRKRSVFPQRKFAVKA*

BS22539.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
RpL35-PC 123 CG4111-PC 1..123 1..123 602 100 Plus
RpL35-PA 123 CG4111-PA 1..123 1..123 602 100 Plus
RpL35-PB 123 CG4111-PB 1..123 1..123 602 100 Plus