Clone BS22547 Report

Search the DGRC for BS22547

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:225
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptVhaM9.7-b-RA
Protein status:BS22547.pep: full length peptide match
Sequenced Size:302

Clone Sequence Records

BS22547.complete Sequence

302 bp assembled on 2011-01-25

GenBank Submission: KX805675

> BS22547.complete
GAAGTTATCAGTCGACATGGTATCCGAGTGGGTGGCACCAATCGTTATCA
CCAGCATTTGGGCCTTCATTGGCATCATCTGCCCCTTCTTCGCCCGAGGA
CCCAACAGGGGGGTGACTCAATGCTGCCTGATGCTCACCGCAGCAACTTG
CTGGCTGTTCTGGCTGTGCTGCTACATGACGCAGCTGAACCCCCTCATCG
GACCCAAACTAAGCATGAACGAAATCATGATCATGGCCCGCGAGTGGGGC
AATGAGATCAAGGACACCATGGCTGTCACCGTCTAAAAGCTTTCTAGACC
AT

BS22547.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-b-RB 270 CG7625-PB 1..270 17..286 1350 100 Plus
VhaM9.7-b-RA 270 CG7625-PA 1..270 17..286 1350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-b-RB 1216 CG7625-RB 127..396 17..286 1350 100 Plus
VhaM9.7-b-RA 699 CG7625-RA 127..396 17..286 1350 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21540269..21540395 160..286 635 100 Plus
3L 28110227 3L 21539988..21540083 17..112 480 100 Plus
3L 28110227 3L 21540152..21540200 111..159 245 100 Plus
3R 32079331 3R 3580243..3580286 280..237 220 100 Minus
Blast to na_te.dros performed on 2014-11-26 14:54:49 has no hits.

BS22547.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:40 Download gff for BS22547.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-b-RA 143..410 17..284 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:45:24 Download gff for BS22547.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-b-RA 127..394 17..284 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:02:38 Download gff for BS22547.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-b-RA 127..394 17..284 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:02:38 Download gff for BS22547.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21539988..21540082 17..111 100 -> Plus
3L 21540153..21540200 112..159 100 -> Plus
3L 21540269..21540393 160..284 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:45:24 Download gff for BS22547.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21533088..21533182 17..111 100 -> Plus
arm_3L 21533253..21533300 112..159 100 -> Plus
arm_3L 21533369..21533493 160..284 100   Plus

BS22547.pep Sequence

Translation from 16 to 285

> BS22547.pep
MVSEWVAPIVITSIWAFIGIICPFFARGPNRGVTQCCLMLTAATCWLFWL
CCYMTQLNPLIGPKLSMNEIMIMAREWGNEIKDTMAVTV*

BS22547.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-b-PB 89 CG7625-PB 1..89 1..89 492 100 Plus
VhaM9.7-b-PA 89 CG7625-PA 1..89 1..89 492 100 Plus
VhaM9.7-a-PC 85 CG1268-PC 9..82 9..81 226 50 Plus
VhaM9.7-a-PB 85 CG1268-PB 9..82 9..81 226 50 Plus
VhaM9.7-c-PA 84 CG11589-PA 8..83 9..83 214 48.7 Plus