BS22547.complete Sequence
302 bp assembled on 2011-01-25
GenBank Submission: KX805675
> BS22547.complete
GAAGTTATCAGTCGACATGGTATCCGAGTGGGTGGCACCAATCGTTATCA
CCAGCATTTGGGCCTTCATTGGCATCATCTGCCCCTTCTTCGCCCGAGGA
CCCAACAGGGGGGTGACTCAATGCTGCCTGATGCTCACCGCAGCAACTTG
CTGGCTGTTCTGGCTGTGCTGCTACATGACGCAGCTGAACCCCCTCATCG
GACCCAAACTAAGCATGAACGAAATCATGATCATGGCCCGCGAGTGGGGC
AATGAGATCAAGGACACCATGGCTGTCACCGTCTAAAAGCTTTCTAGACC
AT
BS22547.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:54:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-b-RB | 270 | CG7625-PB | 1..270 | 17..286 | 1350 | 100 | Plus |
VhaM9.7-b-RA | 270 | CG7625-PA | 1..270 | 17..286 | 1350 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:54:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-b-RB | 1216 | CG7625-RB | 127..396 | 17..286 | 1350 | 100 | Plus |
VhaM9.7-b-RA | 699 | CG7625-RA | 127..396 | 17..286 | 1350 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:54:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 21540269..21540395 | 160..286 | 635 | 100 | Plus |
3L | 28110227 | 3L | 21539988..21540083 | 17..112 | 480 | 100 | Plus |
3L | 28110227 | 3L | 21540152..21540200 | 111..159 | 245 | 100 | Plus |
3R | 32079331 | 3R | 3580243..3580286 | 280..237 | 220 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 14:54:49 has no hits.
BS22547.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:40 Download gff for
BS22547.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-b-RA | 143..410 | 17..284 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:45:24 Download gff for
BS22547.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-b-RA | 127..394 | 17..284 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:02:38 Download gff for
BS22547.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-b-RA | 127..394 | 17..284 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:02:38 Download gff for
BS22547.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 21539988..21540082 | 17..111 | 100 | -> | Plus |
3L | 21540153..21540200 | 112..159 | 100 | -> | Plus |
3L | 21540269..21540393 | 160..284 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:45:24 Download gff for
BS22547.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 21533088..21533182 | 17..111 | 100 | -> | Plus |
arm_3L | 21533253..21533300 | 112..159 | 100 | -> | Plus |
arm_3L | 21533369..21533493 | 160..284 | 100 | | Plus |
BS22547.pep Sequence
Translation from 16 to 285
> BS22547.pep
MVSEWVAPIVITSIWAFIGIICPFFARGPNRGVTQCCLMLTAATCWLFWL
CCYMTQLNPLIGPKLSMNEIMIMAREWGNEIKDTMAVTV*
BS22547.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:08:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-b-PB | 89 | CG7625-PB | 1..89 | 1..89 | 492 | 100 | Plus |
VhaM9.7-b-PA | 89 | CG7625-PA | 1..89 | 1..89 | 492 | 100 | Plus |
VhaM9.7-a-PC | 85 | CG1268-PC | 9..82 | 9..81 | 226 | 50 | Plus |
VhaM9.7-a-PB | 85 | CG1268-PB | 9..82 | 9..81 | 226 | 50 | Plus |
VhaM9.7-c-PA | 84 | CG11589-PA | 8..83 | 9..83 | 214 | 48.7 | Plus |