Clone BS22564 Report

Search the DGRC for BS22564

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:225
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG14977-RA
Protein status:BS22564.pep: full length peptide match
Sequenced Size:395

Clone Sequence Records

BS22564.complete Sequence

395 bp assembled on 2011-01-25

GenBank Submission: KX804158

> BS22564.complete
GAAGTTATCAGTCGACATGTTGAAAATGGACAGGGAAAAGTTGATTGTGC
CCAATCAAATTGGCTATCTGATACTAAAGGAAGATGGAGCAGTTCTGGAG
TCCGGCGGAGATCTGAAGAACGATGAGCGCAGTGCAAATGTGATAATGGG
ATTACTAAATCTCACAGAGACCATCGACGAGTCCTTCATGCCGAGCAGCA
GCTGCGAGAGGATCACCATCGATTACGAGCATCACTACTACAGCATCTGC
ATGTCCAACCGTAGAATATACATCATTAAGATCAGCAAATCGCAGAATGG
CGTCACCACGACCACGAGCTCCTCCTCGTCGAACAGCGTGTATAACGATG
CCAGCGATTCCGGGGCAGTGCTGGCTTGAAAGCTTTCTAGACCAT

BS22564.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG14977-RB 495 CG14977-PB 1..365 17..381 1825 100 Plus
CG14977-RA 363 CG14977-PA 1..363 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:03:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG14977-RB 543 CG14977-RB 38..402 17..381 1825 100 Plus
CG14977-RA 543 CG14977-RA 38..402 17..381 1825 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3897148..3897357 172..381 1050 100 Plus
3L 28110227 3L 3896937..3897091 17..171 775 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:03:14 has no hits.

BS22564.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:54 Download gff for BS22564.complete
Subject Subject Range Query Range Percent Splice Strand
CG14977-RA 43..399 22..378 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:47:23 Download gff for BS22564.complete
Subject Subject Range Query Range Percent Splice Strand
CG14977-RA 43..399 22..378 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:29 Download gff for BS22564.complete
Subject Subject Range Query Range Percent Splice Strand
CG14977-RA 43..399 22..378 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:29 Download gff for BS22564.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3896942..3897091 22..171 100 -> Plus
3L 3897148..3897354 172..378 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:47:23 Download gff for BS22564.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3896942..3897091 22..171 100 -> Plus
arm_3L 3897148..3897354 172..378 100   Plus

BS22564.pep Sequence

Translation from 16 to 378

> BS22564.pep
MLKMDREKLIVPNQIGYLILKEDGAVLESGGDLKNDERSANVIMGLLNLT
ETIDESFMPSSSCERITIDYEHHYYSICMSNRRIYIIKISKSQNGVTTTT
SSSSSNSVYNDASDSGAVLA*

BS22564.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG14977-PA 120 CG14977-PA 1..120 1..120 603 100 Plus
CG14977-PB 164 CG14977-PB 1..120 1..120 603 100 Plus