Clone BS22568 Report

Search the DGRC for BS22568

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:225
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG14324-RA
Protein status:BS22568.pep: gold
Sequenced Size:428

Clone Sequence Records

BS22568.complete Sequence

428 bp assembled on 2011-01-25

GenBank Submission: KX801958

> BS22568.complete
GAAGTTATCAGTCGACATGAGGCAAAACAAGATAACGATTTTGGGTCTGT
CCCTGCTGCTTTGTTTGGCGCTTGCACACTCACATGGTTTTGGTGGAAAG
CTTGGAGGAGGCTACGCCCCTGTCTACAACAACTTTGTCCCATATCCAGT
TGCCCAACCGATCCCAGTGGCCCAACCTGTTCCAGTTCCCGTGGCTATTC
CTCAACCAATTCCAGTCCCAGTCCCCCAACCAGTAGTTATTCCCATCAAA
CACGGATGGAAGGGTGGTCTAGGTCTAGGTGGATTTGGCGGAGGTTATGG
CGGCGGTTTCGGAGGCTACCAGAACTTTGCCTCTGCCTCCTCTTTTAGCT
CTGCCAGTTCATTTGGCGGTGGCTATGGCGGATTGGGTGGTGGCACCTTT
AGGCGGCGCTGAAAGCTTTCTAGACCAT

BS22568.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG14324-RA 396 CG14324-PA 1..396 17..412 1980 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14324-RA 464 CG14324-RA 23..420 15..412 1990 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17618325..17618707 412..30 1915 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:03:41 has no hits.

BS22568.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:55 Download gff for BS22568.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 17..411 17..411 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:47:32 Download gff for BS22568.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 25..419 17..411 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:40 Download gff for BS22568.complete
Subject Subject Range Query Range Percent Splice Strand
CG14324-RA 25..419 17..411 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:40 Download gff for BS22568.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17618326..17618705 32..411 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:47:32 Download gff for BS22568.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13444048..13444427 32..411 100 <- Minus

BS22568.pep Sequence

Translation from 16 to 411

> BS22568.pep
MRQNKITILGLSLLLCLALAHSHGFGGKLGGGYAPVYNNFVPYPVAQPIP
VAQPVPVPVAIPQPIPVPVPQPVVIPIKHGWKGGLGLGGFGGGYGGGFGG
YQNFASASSFSSASSFGGGYGGLGGGTFRRR*

BS22568.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14324-PA 131 CG14324-PA 1..131 1..131 710 100 Plus
CG5070-PA 209 CG5070-PA 90..190 24..125 152 35 Plus
CG10853-PA 155 CG10853-PA 27..92 53..130 137 45.6 Plus