Clone BS22702 Report

Search the DGRC for BS22702

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:227
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG18371-RA
Protein status:BS22702.pep: full length peptide match
Sequenced Size:365

Clone Sequence Records

BS22702.complete Sequence

365 bp assembled on 2011-01-25

GenBank Submission: KX801965

> BS22702.complete
GAAGTTATCAGTCGACATGATGCAGCCAGCGGAACAGATCTTCTCCTGCG
GATTCGAACTCTTCGGGCGAGTACAGGGTGTGTGTTTGCGGAAGCAGACA
CGAGATCTGGCCACAATGAACCAGGTGCGCGGGTGGGTGATGAACACGGA
CGAGGGCACGGTGAAGGGACAGCTGGAGGGCACACTGCCCAAGGTCAACG
TGCTGAAGTTCTGGCTACTGAATATCGGCAGTCCGCGCTCGATTATCGAG
CGGGCGGAATTCACGCCCACCAAGGAGATCACTTCGCACAACTTTAGCCG
ATTCTCGATTCGCTACCACAATGTGGCAGCAACGAAAAAGGCCATTTAAA
AGCTTTCTAGACCAT

BS22702.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG18371-RA 333 CG18371-PA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG18371-RA 477 CG18371-RA 115..447 17..349 1665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14028734..14029066 17..349 1665 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:35:25 has no hits.

BS22702.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:19 Download gff for BS22702.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 117..447 17..347 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:00:38 Download gff for BS22702.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 115..445 17..347 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:07:59 Download gff for BS22702.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 115..445 17..347 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:07:59 Download gff for BS22702.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14028734..14029064 17..347 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:00:38 Download gff for BS22702.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9916239..9916569 17..347 100   Plus

BS22702.pep Sequence

Translation from 16 to 348

> BS22702.pep
MMQPAEQIFSCGFELFGRVQGVCLRKQTRDLATMNQVRGWVMNTDEGTVK
GQLEGTLPKVNVLKFWLLNIGSPRSIIERAEFTPTKEITSHNFSRFSIRY
HNVAATKKAI*

BS22702.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG18371-PA 110 CG18371-PA 1..110 1..110 574 100 Plus
CG34161-PC 125 CG34161-PC 32..124 7..99 250 51.6 Plus
CG34161-PA 125 CG34161-PA 32..124 7..99 250 51.6 Plus
CG34161-PB 120 CG34161-PB 32..119 7..99 231 50.5 Plus
Acyp2-PB 102 CG18505-PB 7..102 5..100 222 46.9 Plus