BS22709.complete Sequence
164 bp assembled on 2011-01-25
GenBank Submission: KX800641
> BS22709.complete
GAAGTTATCAGTAAACATGGAAGTGGAAATGTGGTTCAAAATATCAGCAC
TTCTCAAGGCTGTAACAAAAACTGCACTCTGTTTTTATAAATACAAATAT
CCACAAATATCTGGTCTTAACATGGCAACATTTCAAGTCTTCCAATAAAA
GCTTTCTAGACCAT
BS22709.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-26 16:35:47 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:35:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp33A-RA | 340 | CG6555-RA | 188..320 | 17..149 | 665 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:35:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11591359..11591491 | 149..17 | 665 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:35:46 has no hits.
BS22709.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:21 Download gff for
BS22709.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6555-RA | 188..317 | 17..146 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:00:45 Download gff for
BS22709.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15841-RA | 188..317 | 17..146 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:07 Download gff for
BS22709.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp33A-RA | 188..317 | 17..146 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:07 Download gff for
BS22709.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11591362..11591491 | 17..146 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:00:45 Download gff for
BS22709.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11591362..11591491 | 17..146 | 100 | | Minus |
BS22709.pep Sequence
Translation from 16 to 147
> BS22709.pep
MEVEMWFKISALLKAVTKTALCFYKYKYPQISGLNMATFQVFQ*
Sequence BS22709.pep has no blast hits.