Clone BS22709 Report

Search the DGRC for BS22709

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:227
Well:9
Vector:pDNR-Dual
Associated Gene/TranscriptCG15841-RA
Protein status:BS22709.pep: full length peptide match
Sequenced Size:164

Clone Sequence Records

BS22709.complete Sequence

164 bp assembled on 2011-01-25

GenBank Submission: KX800641

> BS22709.complete
GAAGTTATCAGTAAACATGGAAGTGGAAATGTGGTTCAAAATATCAGCAC
TTCTCAAGGCTGTAACAAAAACTGCACTCTGTTTTTATAAATACAAATAT
CCACAAATATCTGGTCTTAACATGGCAACATTTCAAGTCTTCCAATAAAA
GCTTTCTAGACCAT

BS22709.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-26 16:35:47 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:35:49
Subject Length Description Subject Range Query Range Score Percent Strand
Acp33A-RA 340 CG6555-RA 188..320 17..149 665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11591359..11591491 149..17 665 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:35:46 has no hits.

BS22709.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:21 Download gff for BS22709.complete
Subject Subject Range Query Range Percent Splice Strand
CG6555-RA 188..317 17..146 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:00:45 Download gff for BS22709.complete
Subject Subject Range Query Range Percent Splice Strand
CG15841-RA 188..317 17..146 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:07 Download gff for BS22709.complete
Subject Subject Range Query Range Percent Splice Strand
Acp33A-RA 188..317 17..146 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:07 Download gff for BS22709.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11591362..11591491 17..146 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:00:45 Download gff for BS22709.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11591362..11591491 17..146 100   Minus

BS22709.pep Sequence

Translation from 16 to 147

> BS22709.pep
MEVEMWFKISALLKAVTKTALCFYKYKYPQISGLNMATFQVFQ*
Sequence BS22709.pep has no blast hits.