Clone BS22715 Report

Search the DGRC for BS22715

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:227
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptCG8407-RA
Protein status:BS22715.pep: full length peptide match
Sequenced Size:347

Clone Sequence Records

BS22715.complete Sequence

347 bp assembled on 2011-01-25

GenBank Submission: KX804730

> BS22715.complete
GAAGTTATCAGTCGACATGGCAGACGAGGAGGCCGGCAAGGAGGGCGAGA
AGAAAATCGTGCACGTTTATCCTCTGGTTAAGCACACCGATATGAACGAG
GAGATGCGGATAGAGGCCATTGAACTGTCCATTACCGCCTGCGAGAAATA
CTCATCGAACTACGAGCACGCTGCCAAAATCATCAAGGAGAACATGGACA
AGAAGTTCGGCATCTACTGGCATGTGGTCGTGGGCGAAGGGTTCGGCTTT
GAGGTCTCCTACGAGACGGAGAACATTCTTTATCTGTTCTTCGCCGGCAA
CCTGGCCATCGTGCTGTGGAAGTGCTCCTGAAAGCTTTCTAGACCAT

BS22715.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG8407-RB 315 CG8407-PB 1..315 17..331 1575 100 Plus
CG8407-RA 315 CG8407-PA 1..315 17..331 1575 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG8407-RB 728 CG8407-RB 218..536 14..332 1595 100 Plus
CG8407-RA 612 CG8407-RA 102..420 14..332 1595 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12153904..12154071 165..332 840 100 Plus
2R 25286936 2R 12153640..12153728 78..166 445 100 Plus
2R 25286936 2R 12153510..12153578 14..82 345 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:36:02 has no hits.

BS22715.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:23 Download gff for BS22715.complete
Subject Subject Range Query Range Percent Splice Strand
CG8407-RB 221..534 17..330 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:00:52 Download gff for BS22715.complete
Subject Subject Range Query Range Percent Splice Strand
CG8407-RA 105..418 17..330 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:08:13 Download gff for BS22715.complete
Subject Subject Range Query Range Percent Splice Strand
CG8407-RA 105..418 17..330 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:13 Download gff for BS22715.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12153513..12153578 17..82 100 -> Plus
2R 12153645..12153728 83..166 100 -> Plus
2R 12153906..12154069 167..330 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:00:52 Download gff for BS22715.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8041018..8041083 17..82 100 -> Plus
arm_2R 8041150..8041233 83..166 100 -> Plus
arm_2R 8041411..8041574 167..330 100   Plus

BS22715.pep Sequence

Translation from 16 to 330

> BS22715.pep
MADEEAGKEGEKKIVHVYPLVKHTDMNEEMRIEAIELSITACEKYSSNYE
HAAKIIKENMDKKFGIYWHVVVGEGFGFEVSYETENILYLFFAGNLAIVL
WKCS*

BS22715.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG8407-PB 104 CG8407-PB 1..104 1..104 550 100 Plus
CG8407-PA 104 CG8407-PA 1..104 1..104 550 100 Plus
Cdlc2-PC 89 CG5450-PC 7..87 20..102 168 41 Plus
Cdlc2-PB 89 CG5450-PB 7..87 20..102 168 41 Plus
Cdlc2-PA 89 CG5450-PA 7..87 20..102 168 41 Plus