Clone BS22725 Report

Search the DGRC for BS22725

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:227
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptMst57Da-RA
Protein status:BS22725.pep: gold
Sequenced Size:260

Clone Sequence Records

BS22725.complete Sequence

260 bp assembled on 2011-01-25

GenBank Submission: KX804660

> BS22725.complete
GAAGTTATCAGTCGACATGAAGTTCCTAGCTCTTTTCGTCACTTTGCTGG
TTGTTCTGGCTTTGGTTAGCGCCCAAAAGAGCCAGAATACAAATCACAAC
GTCATCGTCATCGGTGCCAAGAAGCCAGGAGCTGCACCTGCCGCAGCAGC
TGCTGCTGCTCCTGCCGCACCTCCTGCCGCAGCTCCTGCCGCAGCTCCAG
CTGCTCCTGAAGCAGGACTCGCAGATGCTCCAGCCGAAAGTTAAAAGCTT
TCTAGACCAT

BS22725.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Mst57Da-RA 228 CG9074-PA 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Mst57Da-RA 325 CG9074-RA 20..252 13..245 1150 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25831648..25831880 245..13 1150 99.6 Minus
Blast to na_te.dros performed 2014-11-26 15:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
G4 3856 G4 G4_DM 3856bp 724..780 63..6 116 69 Minus

BS22725.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:33 Download gff for BS22725.complete
Subject Subject Range Query Range Percent Splice Strand
Mst57Da-RA 420..645 17..242 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:54:43 Download gff for BS22725.complete
Subject Subject Range Query Range Percent Splice Strand
Mst57Da-RA 24..249 17..242 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:15:32 Download gff for BS22725.complete
Subject Subject Range Query Range Percent Splice Strand
Mst57Da-RA 24..249 17..242 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:15:32 Download gff for BS22725.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25831651..25831876 17..242 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:54:43 Download gff for BS22725.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21657373..21657598 17..242 100   Minus

BS22725.pep Sequence

Translation from 16 to 243

> BS22725.pep
MKFLALFVTLLVVLALVSAQKSQNTNHNVIVIGAKKPGAAPAAAAAAAPA
APPAAAPAAAPAAPEAGLADAPAES*

BS22725.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
Mst57Da-PA 75 CG9074-PA 1..75 1..75 360 100 Plus