BS22725.complete Sequence
260 bp assembled on 2011-01-25
GenBank Submission: KX804660
> BS22725.complete
GAAGTTATCAGTCGACATGAAGTTCCTAGCTCTTTTCGTCACTTTGCTGG
TTGTTCTGGCTTTGGTTAGCGCCCAAAAGAGCCAGAATACAAATCACAAC
GTCATCGTCATCGGTGCCAAGAAGCCAGGAGCTGCACCTGCCGCAGCAGC
TGCTGCTGCTCCTGCCGCACCTCCTGCCGCAGCTCCTGCCGCAGCTCCAG
CTGCTCCTGAAGCAGGACTCGCAGATGCTCCAGCCGAAAGTTAAAAGCTT
TCTAGACCAT
BS22725.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:33:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Mst57Da-RA | 228 | CG9074-PA | 1..228 | 17..244 | 1140 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:33:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Mst57Da-RA | 325 | CG9074-RA | 20..252 | 13..245 | 1150 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:33:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 25831648..25831880 | 245..13 | 1150 | 99.6 | Minus |
Blast to na_te.dros performed 2014-11-26 15:33:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
G4 | 3856 | G4 G4_DM 3856bp | 724..780 | 63..6 | 116 | 69 | Minus |
BS22725.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:33 Download gff for
BS22725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Mst57Da-RA | 420..645 | 17..242 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:54:43 Download gff for
BS22725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Mst57Da-RA | 24..249 | 17..242 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:15:32 Download gff for
BS22725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Mst57Da-RA | 24..249 | 17..242 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:15:32 Download gff for
BS22725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25831651..25831876 | 17..242 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:54:43 Download gff for
BS22725.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 21657373..21657598 | 17..242 | 100 | | Minus |
BS22725.pep Sequence
Translation from 16 to 243
> BS22725.pep
MKFLALFVTLLVVLALVSAQKSQNTNHNVIVIGAKKPGAAPAAAAAAAPA
APPAAAPAAAPAAPEAGLADAPAES*
BS22725.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:11:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Mst57Da-PA | 75 | CG9074-PA | 1..75 | 1..75 | 360 | 100 | Plus |