BS22739.complete Sequence
206 bp assembled on 2011-01-25
GenBank Submission: KX805821
> BS22739.complete
GAAGTTATCAGTCGACATGACTGCCTGGAGAGCTGCCGGAATTACCTACA
TCCAATACTCCAACATCGCCGCTCGCATTTTGCGCGAGTCCTTGAAGACG
GGACTGCGTGCGGATGCCGCCAAGCGCGACGCGAGCCATGTGAAGTTCAC
TCCCTGGGCAAATGGCAAGCCAGCTCATGAAAGGGCTTAGAAGCTTTCTA
GACCAT
BS22739.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:42:28
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| sun-RB | 174 | CG9032-PB | 1..174 | 17..190 | 870 | 100 | Plus |
| sun-RA | 186 | CG9032-PA | 1..161 | 17..177 | 805 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:42:29
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| sun-RB | 450 | CG9032-RB | 95..268 | 17..190 | 870 | 100 | Plus |
| sun-RA | 400 | CG9032-RA | 95..255 | 17..177 | 805 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:42:26
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| X | 23542271 | X | 15848886..15849016 | 176..46 | 655 | 100 | Minus |
| 3R | 32079331 | 3R | 10122032..10122180 | 23..171 | 190 | 75.2 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:42:27 has no hits.
BS22739.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:38 Download gff for
BS22739.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| sun-RB | 77..250 | 17..190 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:42 Download gff for
BS22739.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| sun-RB | 95..268 | 17..190 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:35 Download gff for
BS22739.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| sun-RB | 95..268 | 17..190 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:35 Download gff for
BS22739.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 15848886..15849016 | 46..176 | 100 | <- | Minus |
| X | 15849136..15849164 | 17..45 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:42 Download gff for
BS22739.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_X | 15742919..15743049 | 46..176 | 100 | <- | Minus |
| arm_X | 15743169..15743197 | 17..45 | 100 | | Minus |
BS22739.pep Sequence
Translation from 16 to 189
> BS22739.pep
MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANG
KPAHERA*
BS22739.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:12:19
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| sun-PB | 57 | CG9032-PB | 1..57 | 1..57 | 296 | 100 | Plus |
| sun-PA | 61 | CG9032-PA | 1..56 | 1..56 | 275 | 94.6 | Plus |
| CG31477-PC | 64 | CG31477-PC | 1..52 | 1..52 | 215 | 76.9 | Plus |
| CG31477-PB | 64 | CG31477-PB | 1..52 | 1..52 | 215 | 76.9 | Plus |
| CG31477-PA | 64 | CG31477-PA | 1..52 | 1..52 | 215 | 76.9 | Plus |
