Clone BS22750 Report

Search the DGRC for BS22750

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:227
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptCG34210-RA
Protein status:BS22750.pep: full length peptide match
Sequenced Size:317

Clone Sequence Records

BS22750.complete Sequence

317 bp assembled on 2011-01-25

GenBank Submission: KX804097

> BS22750.complete
GAAGTTATCAGTCGACATGAAGAAGTCCGGGGACTTTCTCTCCCTGCTCA
ACAATCGCGACCTGCTGAAGACTCCGTCCGGCAACTCCATTGTGAACTTC
CTGGTGAAACCGATGAGCGTGGAAATGAACACGGCGGACAATCTGATCAC
GGGTGCCAGGCGCCAGCGAATGATGGAGCTCTTCCAGGAGGACCGCGCCT
GGGAGGCCGCCGAGTTGTCCCGCTTCGGACTGAGCTGCATCAAGGCCCCG
GACTGCTATCCCTGCTGCACTCCTTTCGAGTGCTCCAAGGCCAAGTTCTA
GAAGCTTTCTAGACCAT

BS22750.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG34210-RA 285 CG34210-PA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG34210-RA 565 CG34210-RA 106..390 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23351705..23351969 37..301 1325 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:50:29 has no hits.

BS22750.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:44 Download gff for BS22750.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 40..324 17..301 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:58:28 Download gff for BS22750.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 106..390 17..301 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:22 Download gff for BS22750.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 106..390 17..301 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:22 Download gff for BS22750.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23351705..23351969 37..301 100   Plus
2R 23351623..23351642 17..36 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:58:28 Download gff for BS22750.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19239228..19239492 37..301 100   Plus
arm_2R 19239146..19239165 17..36 100 -> Plus

BS22750.pep Sequence

Translation from 16 to 300

> BS22750.pep
MKKSGDFLSLLNNRDLLKTPSGNSIVNFLVKPMSVEMNTADNLITGARRQ
RMMELFQEDRAWEAAELSRFGLSCIKAPDCYPCCTPFECSKAKF*

BS22750.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG34210-PA 94 CG34210-PA 1..94 1..94 498 100 Plus