BS22751.complete Sequence
209 bp assembled on 2011-01-25
GenBank Submission: KX801543
> BS22751.complete
GAAGTTATCAGTCGACATGGCAGTCCTGCGTGGTTGGAGATTCGTTGGAT
TCGTGTCCTGCATCGTGGGCGCCGTGGGCCTCACCCTATACCCCGTCATT
GTGGACCCCATGGTTAACACTGAGAAATACAAAACCCTGCAGGAATACAG
CAAAATCAAGAGAGATGAACTGCAGCACATTAAAAGGCAGTAGAAGCTTT
CTAGACCAT
BS22751.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:05:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34242-RB | 177 | CG34242-PB | 1..177 | 17..193 | 885 | 100 | Plus |
CG34242-RA | 177 | CG34242-PA | 1..177 | 17..193 | 885 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:05:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34242-RB | 343 | CG34242-RB | 14..192 | 17..195 | 895 | 100 | Plus |
CG34242-RA | 366 | CG34242-RA | 30..208 | 17..195 | 895 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:05:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 12534067..12534245 | 17..195 | 895 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:05:27 has no hits.
BS22751.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:59 Download gff for
BS22751.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 30..206 | 17..193 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:48:02 Download gff for
BS22751.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 30..206 | 17..193 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:06:19 Download gff for
BS22751.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 30..206 | 17..193 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:06:19 Download gff for
BS22751.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 12534067..12534243 | 17..193 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:48:02 Download gff for
BS22751.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 12527167..12527343 | 17..193 | 100 | | Plus |
BS22751.pep Sequence
Translation from 16 to 192
> BS22751.pep
MAVLRGWRFVGFVSCIVGAVGLTLYPVIVDPMVNTEKYKTLQEYSKIKRD
ELQHIKRQ*
BS22751.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:06:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34242-PB | 58 | CG34242-PB | 1..58 | 1..58 | 301 | 100 | Plus |
CG34242-PA | 58 | CG34242-PA | 1..58 | 1..58 | 301 | 100 | Plus |