Clone BS22751 Report

Search the DGRC for BS22751

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:227
Well:51
Vector:pDNR-Dual
Associated Gene/TranscriptCG34242-RA
Protein status:BS22751.pep: full length peptide match
Sequenced Size:209

Clone Sequence Records

BS22751.complete Sequence

209 bp assembled on 2011-01-25

GenBank Submission: KX801543

> BS22751.complete
GAAGTTATCAGTCGACATGGCAGTCCTGCGTGGTTGGAGATTCGTTGGAT
TCGTGTCCTGCATCGTGGGCGCCGTGGGCCTCACCCTATACCCCGTCATT
GTGGACCCCATGGTTAACACTGAGAAATACAAAACCCTGCAGGAATACAG
CAAAATCAAGAGAGATGAACTGCAGCACATTAAAAGGCAGTAGAAGCTTT
CTAGACCAT

BS22751.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34242-RB 177 CG34242-PB 1..177 17..193 885 100 Plus
CG34242-RA 177 CG34242-PA 1..177 17..193 885 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34242-RB 343 CG34242-RB 14..192 17..195 895 100 Plus
CG34242-RA 366 CG34242-RA 30..208 17..195 895 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12534067..12534245 17..195 895 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:05:27 has no hits.

BS22751.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:16:59 Download gff for BS22751.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 30..206 17..193 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:48:02 Download gff for BS22751.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 30..206 17..193 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:06:19 Download gff for BS22751.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 30..206 17..193 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:06:19 Download gff for BS22751.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12534067..12534243 17..193 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:48:02 Download gff for BS22751.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12527167..12527343 17..193 100   Plus

BS22751.pep Sequence

Translation from 16 to 192

> BS22751.pep
MAVLRGWRFVGFVSCIVGAVGLTLYPVIVDPMVNTEKYKTLQEYSKIKRD
ELQHIKRQ*

BS22751.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34242-PB 58 CG34242-PB 1..58 1..58 301 100 Plus
CG34242-PA 58 CG34242-PA 1..58 1..58 301 100 Plus