BS22752.complete Sequence
299 bp assembled on 2011-01-25
GenBank Submission: KX804932
> BS22752.complete
GAAGTTATCAGTCGACATGCCAAGTCATTGGCCATGTCTTTTGATCCTGC
TTGTTGTAATCGTACTCATCCTAGCTGTTTGCGGATACTACACAATTATT
CACCCGAAACAGATTCATCTGGAAAGCTGTTTTCTCAAAGGCGGGGCCTG
CCGGGAAACGTGGAACTGCGACGAAAGGTACCGCAGTCGCGTTCGCACCA
CGTGTATCAACAAACGAAAGGTCTGCTGCATGCCCACGCTCCAGATAAAG
AGCATTCAGGATGCCGAGTACTACATCGAGTGAAAGCTTTCTAGACCAT
BS22752.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:47:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34286-RB | 267 | CG34286-PB | 1..267 | 17..283 | 1335 | 100 | Plus |
CG34286-RA | 267 | CG34286-PA | 1..267 | 17..283 | 1335 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:47:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34286-RB | 686 | CG34286-RB | 95..362 | 17..284 | 1340 | 100 | Plus |
CG34286-RA | 520 | CG34286-RA | 95..362 | 17..284 | 1340 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:47:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 19715510..19715677 | 284..117 | 840 | 100 | Minus |
3R | 32079331 | 3R | 19715734..19715833 | 116..17 | 500 | 100 | Minus |
Blast to na_te.dros performed 2014-11-26 15:47:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
rooA | 7621 | rooA ROOA_LTR 7621bp | 5363..5388 | 139..114 | 103 | 88.5 | Minus |
BS22752.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:42 Download gff for
BS22752.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 95..360 | 17..282 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:54 Download gff for
BS22752.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 95..360 | 17..282 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:20:31 Download gff for
BS22752.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 95..360 | 17..282 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:31 Download gff for
BS22752.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19715512..19715677 | 117..282 | 100 | <- | Minus |
3R | 19715734..19715833 | 17..116 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:54 Download gff for
BS22752.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 15541234..15541399 | 117..282 | 100 | <- | Minus |
arm_3R | 15541456..15541555 | 17..116 | 100 | | Minus |
BS22752.pep Sequence
Translation from 16 to 282
> BS22752.pep
MPSHWPCLLILLVVIVLILAVCGYYTIIHPKQIHLESCFLKGGACRETWN
CDERYRSRVRTTCINKRKVCCMPTLQIKSIQDAEYYIE*
BS22752.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:06:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34286-PB | 88 | CG34286-PB | 1..88 | 1..88 | 487 | 100 | Plus |
CG34286-PA | 88 | CG34286-PA | 1..88 | 1..88 | 487 | 100 | Plus |