Clone BS22752 Report

Search the DGRC for BS22752

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:227
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG34286-RA
Protein status:BS22752.pep: full length peptide match
Sequenced Size:299

Clone Sequence Records

BS22752.complete Sequence

299 bp assembled on 2011-01-25

GenBank Submission: KX804932

> BS22752.complete
GAAGTTATCAGTCGACATGCCAAGTCATTGGCCATGTCTTTTGATCCTGC
TTGTTGTAATCGTACTCATCCTAGCTGTTTGCGGATACTACACAATTATT
CACCCGAAACAGATTCATCTGGAAAGCTGTTTTCTCAAAGGCGGGGCCTG
CCGGGAAACGTGGAACTGCGACGAAAGGTACCGCAGTCGCGTTCGCACCA
CGTGTATCAACAAACGAAAGGTCTGCTGCATGCCCACGCTCCAGATAAAG
AGCATTCAGGATGCCGAGTACTACATCGAGTGAAAGCTTTCTAGACCAT

BS22752.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34286-RB 267 CG34286-PB 1..267 17..283 1335 100 Plus
CG34286-RA 267 CG34286-PA 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG34286-RB 686 CG34286-RB 95..362 17..284 1340 100 Plus
CG34286-RA 520 CG34286-RA 95..362 17..284 1340 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19715510..19715677 284..117 840 100 Minus
3R 32079331 3R 19715734..19715833 116..17 500 100 Minus
Blast to na_te.dros performed 2014-11-26 15:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
rooA 7621 rooA ROOA_LTR 7621bp 5363..5388 139..114 103 88.5 Minus

BS22752.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:42 Download gff for BS22752.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 95..360 17..282 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:54 Download gff for BS22752.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 95..360 17..282 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:20:31 Download gff for BS22752.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 95..360 17..282 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:31 Download gff for BS22752.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19715512..19715677 117..282 100 <- Minus
3R 19715734..19715833 17..116 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:54 Download gff for BS22752.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15541234..15541399 117..282 100 <- Minus
arm_3R 15541456..15541555 17..116 100   Minus

BS22752.pep Sequence

Translation from 16 to 282

> BS22752.pep
MPSHWPCLLILLVVIVLILAVCGYYTIIHPKQIHLESCFLKGGACRETWN
CDERYRSRVRTTCINKRKVCCMPTLQIKSIQDAEYYIE*

BS22752.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG34286-PB 88 CG34286-PB 1..88 1..88 487 100 Plus
CG34286-PA 88 CG34286-PA 1..88 1..88 487 100 Plus