Clone BS22753 Report

Search the DGRC for BS22753

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:227
Well:53
Vector:pDNR-Dual
Associated Gene/TranscriptCG11741-RA
Protein status:BS22753.pep: gold
Sequenced Size:236

Clone Sequence Records

BS22753.complete Sequence

236 bp assembled on 2011-01-25

GenBank Submission: KX800798

> BS22753.complete
GAAGTTATCAGTCGACATGACGTCTCCCTTCGACGGCATTGCCTGCTTCT
GGCTGTCACTAGTCTGGATTCAACTGGGTATCATCAATGCCGGCCTGGAG
TTCCTCAAGGATTTCGTACCCCTTCAGCTGGTGCGGCTGAGAGAGATCGA
GGACGAAGAGCGGGAAATCGAGGGCGAGTGCACCCTGGGAGCCATCAGCA
TTCGTATGTTCGCCTTTTAAAAGCTTTCTAGACCAT

BS22753.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG11741-RB 204 CG11741-PB 1..204 17..220 1020 100 Plus
CG11741-RA 204 CG11741-PA 1..204 17..220 1020 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG11741-RB 356 CG11741-RB 15..218 17..220 1020 100 Plus
CG11741-RA 455 CG11741-RA 15..218 17..220 1020 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:51:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8528660..8528863 220..17 1020 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:51:12 has no hits.

BS22753.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:45 Download gff for BS22753.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 15..216 17..218 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:58:35 Download gff for BS22753.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 15..216 17..218 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:37 Download gff for BS22753.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 15..216 17..218 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:37 Download gff for BS22753.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8528662..8528863 17..218 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:58:35 Download gff for BS22753.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4354384..4354585 17..218 100   Minus

BS22753.pep Sequence

Translation from 16 to 219

> BS22753.pep
MTSPFDGIACFWLSLVWIQLGIINAGLEFLKDFVPLQLVRLREIEDEERE
IEGECTLGAISIRMFAF*

BS22753.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG11741-PB 67 CG11741-PB 1..67 1..67 347 100 Plus
CG11741-PA 67 CG11741-PA 1..67 1..67 347 100 Plus