BS22753.complete Sequence
236 bp assembled on 2011-01-25
GenBank Submission: KX800798
> BS22753.complete
GAAGTTATCAGTCGACATGACGTCTCCCTTCGACGGCATTGCCTGCTTCT
GGCTGTCACTAGTCTGGATTCAACTGGGTATCATCAATGCCGGCCTGGAG
TTCCTCAAGGATTTCGTACCCCTTCAGCTGGTGCGGCTGAGAGAGATCGA
GGACGAAGAGCGGGAAATCGAGGGCGAGTGCACCCTGGGAGCCATCAGCA
TTCGTATGTTCGCCTTTTAAAAGCTTTCTAGACCAT
BS22753.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:51:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11741-RB | 204 | CG11741-PB | 1..204 | 17..220 | 1020 | 100 | Plus |
CG11741-RA | 204 | CG11741-PA | 1..204 | 17..220 | 1020 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:51:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11741-RB | 356 | CG11741-RB | 15..218 | 17..220 | 1020 | 100 | Plus |
CG11741-RA | 455 | CG11741-RA | 15..218 | 17..220 | 1020 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:51:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 8528660..8528863 | 220..17 | 1020 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:51:12 has no hits.
BS22753.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:45 Download gff for
BS22753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 15..216 | 17..218 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:58:35 Download gff for
BS22753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 15..216 | 17..218 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:37 Download gff for
BS22753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 15..216 | 17..218 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:37 Download gff for
BS22753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8528662..8528863 | 17..218 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:58:35 Download gff for
BS22753.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 4354384..4354585 | 17..218 | 100 | | Minus |
BS22753.pep Sequence
Translation from 16 to 219
> BS22753.pep
MTSPFDGIACFWLSLVWIQLGIINAGLEFLKDFVPLQLVRLREIEDEERE
IEGECTLGAISIRMFAF*
BS22753.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11741-PB | 67 | CG11741-PB | 1..67 | 1..67 | 347 | 100 | Plus |
CG11741-PA | 67 | CG11741-PA | 1..67 | 1..67 | 347 | 100 | Plus |