Clone BS22757 Report

Search the DGRC for BS22757

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:227
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG34241-RA
Protein status:BS22757.pep: full length peptide match
Sequenced Size:281

Clone Sequence Records

BS22757.complete Sequence

281 bp assembled on 2011-01-25

GenBank Submission: KX804124

> BS22757.complete
GAAGTTATCAGTCGACATGGATAGGGGTACGTCTTCAAATCAGCCCATCC
TGACCACCTGTGAGATGTATCCGCGCCGAAGGAACACGGAGTTCTACAGA
TCCCCGGAACCGAGAGTCTCCTGCCAAAACCAACGAGCGGAACATCCGGG
GCAGATGCTCAACGTGACTCCCGACGAGAATCGGGAGGCCGTACGAAGAC
TTCCACGAATCCAGCCGCCAAATAATTTGGATAGTGTTTATCTACGCAAT
GGTTACTTTTCGTAAAAGCTTTCTAGACCAT

BS22757.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34241-RA 249 CG34241-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG34241-RA 427 CG34241-RA 120..371 16..267 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12128185..12128405 47..267 1105 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:52:20 has no hits.

BS22757.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:44 Download gff for BS22757.complete
Subject Subject Range Query Range Percent Splice Strand
CG34241-RA 76..322 17..263 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:58:48 Download gff for BS22757.complete
Subject Subject Range Query Range Percent Splice Strand
CG34241-RA 121..367 17..263 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:57 Download gff for BS22757.complete
Subject Subject Range Query Range Percent Splice Strand
CG34241-RA 121..367 17..263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:57 Download gff for BS22757.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12128099..12128128 17..46 100 -> Plus
3L 12128185..12128401 47..263 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:58:48 Download gff for BS22757.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12121199..12121228 17..46 100 -> Plus
arm_3L 12121285..12121501 47..263 100   Plus

BS22757.pep Sequence

Translation from 16 to 264

> BS22757.pep
MDRGTSSNQPILTTCEMYPRRRNTEFYRSPEPRVSCQNQRAEHPGQMLNV
TPDENREAVRRLPRIQPPNNLDSVYLRNGYFS*

BS22757.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG34241-PA 82 CG34241-PA 1..82 1..82 444 100 Plus