Clone BS22765 Report

Search the DGRC for BS22765

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:227
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG13068-RA
Protein status:BS22765.pep: full length peptide match
Sequenced Size:362

Clone Sequence Records

BS22765.complete Sequence

362 bp assembled on 2011-01-25

GenBank Submission: KX804116

> BS22765.complete
GAAGTTATCAGTCGACATGTTCAAGCTGTCTGCCCTCGTTGTCCTGTGCG
CTCTGGTGGCCTGCTCCTCGGCTGAGCCCAAGCCCGCTATCCTGGCCGCC
GCTCCAGTGGTTGCAGCTGCTCCTGCCGGCGTGGTCACCGCTACCAGTTC
GCAGTACGTGGCCCGCAACTTCAACGGTGTGGCTGCTGCTCCAGTTGTTG
CCGCTGCCTACACCGCTCCAGTTGCCGCCGCTGCCTATACCGCTCCAGTT
GCCGCCGCTGCTTATACCGCTCCAGTTGCCGCTGCCTACTCTGCTTATCC
GTATGCCGCCTACCCTTACAGCGCTGCATACACCACTGTTTTGTAAAAGC
TTTCTAGACCAT

BS22765.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG13068-RA 330 CG13068-PA 1..330 17..346 1650 100 Plus
CG13068-RA 330 CG13068-PA 172..239 215..282 280 94.1 Plus
CG13068-RA 330 CG13068-PA 199..266 188..255 280 94.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:24:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13068-RA 450 CG13068-RA 43..375 16..348 1665 100 Plus
CG13068-RA 450 CG13068-RA 242..309 188..255 280 94.1 Plus
CG13068-RA 450 CG13068-RA 215..282 215..282 280 94.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16269516..16269836 28..348 1605 100 Plus
3L 28110227 3L 16269676..16269743 215..282 280 94.1 Plus
3L 28110227 3L 16269703..16269770 188..255 280 94.1 Plus
Blast to na_te.dros performed 2014-11-26 15:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2434..2539 283..178 134 62.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2747..2799 228..176 103 66 Minus

BS22765.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-25 17:17:49 Download gff for BS22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 49..371 22..344 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:00:30 Download gff for BS22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 49..371 22..344 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:40:39 Download gff for BS22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 49..371 22..344 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:40:39 Download gff for BS22765.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16269510..16269832 22..344 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:00:30 Download gff for BS22765.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16262610..16262932 22..344 98   Plus

BS22765.pep Sequence

Translation from 16 to 345

> BS22765.pep
MFKLSALVVLCALVACSSAEPKPAILAAAPVVAAAPAGVVTATSSQYVAR
NFNGVAAAPVVAAAYTAPVAAAAYTAPVAAAAYTAPVAAAYSAYPYAAYP
YSAAYTTVL*

BS22765.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG13068-PA 109 CG13068-PA 1..109 1..109 531 100 Plus
CG18294-PA 141 CG18294-PA 1..129 1..109 205 47 Plus
825-Oak-PB 129 CG32208-PB 1..118 1..109 202 47.5 Plus
CG32213-PB 129 CG32213-PB 1..118 1..109 199 46.7 Plus
CG12519-PB 131 CG12519-PB 1..120 1..109 195 45.3 Plus